BLASTX nr result
ID: Paeonia25_contig00021211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00021211 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006425713.1| hypothetical protein CICLE_v10025762mg [Citr... 77 3e-12 ref|XP_004233512.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 ref|XP_002271426.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 emb|CBI17546.3| unnamed protein product [Vitis vinifera] 77 3e-12 emb|CAN68320.1| hypothetical protein VITISV_032192 [Vitis vinifera] 77 3e-12 ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfam... 75 1e-11 gb|EXB59125.1| hypothetical protein L484_014620 [Morus notabilis] 73 5e-11 ref|XP_004300620.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_006363148.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_004232380.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 gb|ABU45207.1| unknown [Solanum bulbocastanum] 70 2e-10 emb|CAA05629.1| membrane-associated salt-inducible protein like ... 69 9e-10 ref|XP_002866998.1| pentatricopeptide repeat-containing protein ... 69 9e-10 gb|ABU45188.1| unknown [Capsicum frutescens] 69 9e-10 ref|NP_195386.1| pentatricopeptide repeat-containing protein [Ar... 69 9e-10 gb|ABU45192.1| unknown [Petunia integrifolia subsp. inflata] 68 1e-09 ref|XP_006411973.1| hypothetical protein EUTSA_v10027579mg [Eutr... 68 2e-09 gb|ABU45173.1| unknown [Solanum melongena] 67 2e-09 ref|XP_006282615.1| hypothetical protein CARUB_v10004839mg, part... 66 4e-09 gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] 65 1e-08 >ref|XP_006425713.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] gi|568824774|ref|XP_006466769.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Citrus sinensis] gi|557527703|gb|ESR38953.1| hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 77.0 bits (188), Expect = 3e-12 Identities = 44/80 (55%), Positives = 48/80 (60%) Frame = +3 Query: 24 SSLRHVRLLCXXXXXXXXXXXXXXXXXXXXXXXXXXXLRSEHDPDKALEIYSSVSNHYTS 203 +SLRH+R LC LRSE DPDKALEIYSSVS HY S Sbjct: 2 TSLRHIRRLCTATTAAGSSTTASSISVSKAKSK----LRSEFDPDKALEIYSSVSKHYAS 57 Query: 204 PVSSRYPQDLTVKRLAKSRR 263 PVSSRY QDLTV+RLAKS+R Sbjct: 58 PVSSRYAQDLTVRRLAKSKR 77 >ref|XP_004233512.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum lycopersicum] Length = 416 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L+SEHDPDKAL+IYSSVSNHYTSP+SSRY Q+ TVKRLAKS R Sbjct: 45 LKSEHDPDKALKIYSSVSNHYTSPLSSRYAQEYTVKRLAKSHR 87 >ref|XP_002271426.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Vitis vinifera] Length = 414 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LRSE DPD+ALEIYSSVS HYTSP++SRY QDLTVKRLAKSRR Sbjct: 44 LRSEFDPDRALEIYSSVSKHYTSPLASRYAQDLTVKRLAKSRR 86 >emb|CBI17546.3| unnamed protein product [Vitis vinifera] Length = 371 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LRSE DPD+ALEIYSSVS HYTSP++SRY QDLTVKRLAKSRR Sbjct: 44 LRSEFDPDRALEIYSSVSKHYTSPLASRYAQDLTVKRLAKSRR 86 >emb|CAN68320.1| hypothetical protein VITISV_032192 [Vitis vinifera] Length = 416 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LRSE DPD+ALEIYSSVS HYTSP++SRY QDLTVKRLAKSRR Sbjct: 46 LRSEFDPDRALEIYSSVSKHYTSPLASRYAQDLTVKRLAKSRR 88 >ref|XP_007046988.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508699249|gb|EOX91145.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR+E+DPDKALEIYSSVS HY+SP SSRY QDLTV+RLAKSRR Sbjct: 38 LRTEYDPDKALEIYSSVSKHYSSPSSSRYAQDLTVRRLAKSRR 80 >gb|EXB59125.1| hypothetical protein L484_014620 [Morus notabilis] Length = 400 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR EHDPDKALEIYSSVS+ Y+SP SRY QDLTV+RLAKSRR Sbjct: 28 LRGEHDPDKALEIYSSVSDRYSSPTISRYAQDLTVRRLAKSRR 70 >ref|XP_004300620.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 461 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LRSEHDPDKALEIYSSVS+ Y+SP SSRY QD+ V+RLAKS R Sbjct: 31 LRSEHDPDKALEIYSSVSDRYSSPTSSRYTQDIAVRRLAKSHR 73 >ref|XP_006363148.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum tuberosum] Length = 406 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L++EHDPDKALEIYSSVS+ Y SP+SSRY Q+ TVKRLAKS R Sbjct: 41 LKAEHDPDKALEIYSSVSDRYVSPLSSRYAQEFTVKRLAKSHR 83 >ref|XP_004232380.1| PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Solanum lycopersicum] Length = 405 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L++EHDPDKALEIYSSVS+ Y SP+SSRY Q+ TVKRLAKS R Sbjct: 40 LKAEHDPDKALEIYSSVSDRYVSPLSSRYAQEFTVKRLAKSHR 82 >gb|ABU45207.1| unknown [Solanum bulbocastanum] Length = 405 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L++EHDPDKALEIYSSVS+ Y SP+SSRY Q+ TVKRLAKS R Sbjct: 40 LKAEHDPDKALEIYSSVSDRYVSPLSSRYAQEFTVKRLAKSHR 82 >emb|CAA05629.1| membrane-associated salt-inducible protein like [Arabidopsis thaliana] Length = 428 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR EHDPDKAL+IY++VS+H SPVSSRY Q+LTV+RLAK RR Sbjct: 56 LRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCRR 98 >ref|XP_002866998.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312834|gb|EFH43257.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR EHDPDKAL+IY++VS+H SPVSSRY Q+LTV+RLAK RR Sbjct: 40 LRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCRR 82 >gb|ABU45188.1| unknown [Capsicum frutescens] Length = 373 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L++EHDPDKAL+IYSSVS+ Y SP+SSRY Q+ TVKRLAKS R Sbjct: 21 LKAEHDPDKALQIYSSVSDRYISPLSSRYAQEYTVKRLAKSHR 63 >ref|NP_195386.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181418|sp|Q9M065.1|PP352_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g36680, mitochondrial; Flags: Precursor gi|2464912|emb|CAB16807.1| salt-inducible like protein [Arabidopsis thaliana] gi|7270616|emb|CAB80334.1| salt-inducible like protein [Arabidopsis thaliana] gi|17381286|gb|AAL36061.1| C7A10_680/C7A10_680 [Arabidopsis thaliana] gi|24111267|gb|AAN46757.1| At4g36680/C7A10_680 [Arabidopsis thaliana] gi|332661286|gb|AEE86686.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 412 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR EHDPDKAL+IY++VS+H SPVSSRY Q+LTV+RLAK RR Sbjct: 40 LRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCRR 82 >gb|ABU45192.1| unknown [Petunia integrifolia subsp. inflata] Length = 406 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L++EHDPDK LEIYSSVS+ Y SP+SSRY Q+ TVKRLAKS R Sbjct: 38 LKAEHDPDKVLEIYSSVSDRYISPLSSRYAQEYTVKRLAKSHR 80 >ref|XP_006411973.1| hypothetical protein EUTSA_v10027579mg [Eutrema salsugineum] gi|557113143|gb|ESQ53426.1| hypothetical protein EUTSA_v10027579mg [Eutrema salsugineum] Length = 410 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR HDPDKALEIYS+VSNH SPVSSRY Q+LTV+RLAK R Sbjct: 44 LRKVHDPDKALEIYSNVSNHDASPVSSRYAQELTVRRLAKCSR 86 >gb|ABU45173.1| unknown [Solanum melongena] Length = 427 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 L++EHDPDKALEIYSSVS+ Y SP+SSRY Q+ VKRLAKS R Sbjct: 38 LKAEHDPDKALEIYSSVSDRYISPLSSRYAQEYIVKRLAKSHR 80 >ref|XP_006282615.1| hypothetical protein CARUB_v10004839mg, partial [Capsella rubella] gi|482551320|gb|EOA15513.1| hypothetical protein CARUB_v10004839mg, partial [Capsella rubella] Length = 435 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR EHDPDKAL+IY++VS+H SPVSSRY Q+LTV+RLAK R Sbjct: 67 LRKEHDPDKALKIYANVSDHSASPVSSRYAQELTVRRLAKCSR 109 >gb|AEI98618.1| hypothetical protein 111O18.5 [Coffea canephora] Length = 417 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 135 LRSEHDPDKALEIYSSVSNHYTSPVSSRYPQDLTVKRLAKSRR 263 LR +DPDKALEIYSSVS +YTSP+SSRY Q+ TV+RLAKS R Sbjct: 50 LRYVYDPDKALEIYSSVSPNYTSPLSSRYTQEYTVRRLAKSHR 92