BLASTX nr result
ID: Paeonia25_contig00021148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00021148 (779 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD34657.1| hypothetical protein CERSUDRAFT_86069 [Ceriporiop... 57 1e-05 >gb|EMD34657.1| hypothetical protein CERSUDRAFT_86069 [Ceriporiopsis subvermispora B] Length = 289 Score = 56.6 bits (135), Expect = 1e-05 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +1 Query: 286 KTCNVRLPIEVHERIIGFMGPTYRGPWSR-TVANCALVCRAWLPFSRFKLYDSIDLRS 456 ++C RLP+E+ E II +G P+ R +V +CALVCRAWLP SRF+L+ S+ LR+ Sbjct: 54 QSCGKRLPLELWETIIDHLG----NPFDRQSVLSCALVCRAWLPRSRFRLFHSVYLRT 107