BLASTX nr result
ID: Paeonia25_contig00020835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00020835 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007370305.1| hypothetical protein DICSQDRAFT_163641 [Dich... 55 8e-06 >ref|XP_007370305.1| hypothetical protein DICSQDRAFT_163641 [Dichomitus squalens LYAD-421 SS1] gi|395324485|gb|EJF56924.1| hypothetical protein DICSQDRAFT_163641 [Dichomitus squalens LYAD-421 SS1] Length = 911 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +3 Query: 144 VGSSPGLEQEIPDDAMLPKEGAEEILRSLDPAVMPLGIITL 266 VG G EQ +P DA+L KEG +E L+S+DPAVMPLGIITL Sbjct: 530 VGGWRGWEQSMPADAVLTKEGVDEFLQSVDPAVMPLGIITL 570