BLASTX nr result
ID: Paeonia25_contig00020704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00020704 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273984.2| PREDICTED: C2 and GRAM domain-containing pro... 60 3e-07 >ref|XP_002273984.2| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Vitis vinifera] gi|296084286|emb|CBI24674.3| unnamed protein product [Vitis vinifera] Length = 588 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 2/44 (4%) Frame = +3 Query: 3 AGAIDECKKEVESMLEMARSYIKSKTSGGRTDETP--SSPVAQD 128 +GAI+E KKEVE+MLE+ARSYIKSKTSGG ++ P SSPV QD Sbjct: 543 SGAINEYKKEVETMLEVARSYIKSKTSGGEIEDAPSSSSPVLQD 586