BLASTX nr result
ID: Paeonia25_contig00020528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00020528 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007363092.1| hypothetical protein DICSQDRAFT_160095 [Dich... 60 4e-07 >ref|XP_007363092.1| hypothetical protein DICSQDRAFT_160095 [Dichomitus squalens LYAD-421 SS1] gi|395331901|gb|EJF64281.1| hypothetical protein DICSQDRAFT_160095 [Dichomitus squalens LYAD-421 SS1] Length = 517 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 1/74 (1%) Frame = -1 Query: 267 FVQEQPLRVYAIACIMGLESEARRAAEVTKQNSTLQVDIQLRELDELPAGYYHRLMRFH- 91 FV+ QPL V+A+ACI+ LE EAR AAE L +D L EL ++ AG Y+RL++FH Sbjct: 124 FVKSQPLSVWALACILRLEPEARIAAEAL-LGKDLPIDAPL-ELQDISAGTYYRLVKFHR 181 Query: 90 AQAEGADRFTFTIP 49 A+ + ++F FT P Sbjct: 182 AKGDVGEQFKFTEP 195