BLASTX nr result
ID: Paeonia25_contig00019965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00019965 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB11200.1| copia-type polyprotein [Arabidopsis thaliana] gi... 59 9e-07 gb|AAG51247.1|AC055769_6 copia-type polyprotein, putative; 28768... 59 9e-07 ref|XP_003637286.1| hypothetical protein MTR_080s0034 [Medicago ... 56 4e-06 ref|XP_004487749.1| PREDICTED: uncharacterized protein LOC101506... 55 8e-06 >dbj|BAB11200.1| copia-type polyprotein [Arabidopsis thaliana] gi|13872710|emb|CAC37622.1| polyprotein [Arabidopsis thaliana] Length = 1334 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -2 Query: 116 SDKDGKLCIPKFDGDYEHWAMLMENLLRYRECWHLVET 3 S+K+ + IPKFDGDYEHWAMLMENL+R +E W ++ET Sbjct: 2 SEKESVI-IPKFDGDYEHWAMLMENLIRSKEWWDIIET 38 >gb|AAG51247.1|AC055769_6 copia-type polyprotein, putative; 28768-32772 [Arabidopsis thaliana] Length = 1334 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -2 Query: 116 SDKDGKLCIPKFDGDYEHWAMLMENLLRYRECWHLVET 3 S+K+ + IPKFDGDYEHWAMLMENL+R +E W ++ET Sbjct: 2 SEKESVI-IPKFDGDYEHWAMLMENLIRSKEWWDIIET 38 >ref|XP_003637286.1| hypothetical protein MTR_080s0034 [Medicago truncatula] gi|355503221|gb|AES84424.1| hypothetical protein MTR_080s0034 [Medicago truncatula] Length = 332 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 92 IPKFDGDYEHWAMLMENLLRYRECWHLVE 6 IPKFDG Y+HWAMLMEN LR +E WHLVE Sbjct: 13 IPKFDGHYDHWAMLMENFLRSKEYWHLVE 41 >ref|XP_004487749.1| PREDICTED: uncharacterized protein LOC101506462 [Cicer arietinum] Length = 384 Score = 55.5 bits (132), Expect = 8e-06 Identities = 19/30 (63%), Positives = 27/30 (90%) Frame = -2 Query: 95 CIPKFDGDYEHWAMLMENLLRYRECWHLVE 6 C+PKFDGDY+HW+++MENLLR +E W ++E Sbjct: 11 CLPKFDGDYDHWSLIMENLLRSKEYWSIIE 40