BLASTX nr result
ID: Paeonia25_contig00019620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00019620 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006435708.1| hypothetical protein CICLE_v10033015mg [Citr... 81 2e-13 ref|XP_002312150.2| pleckstrin homology domain-containing family... 81 2e-13 ref|XP_007009031.1| Pleckstrin (PH) domain superfamily protein [... 81 2e-13 ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-contai... 81 2e-13 ref|XP_002315163.2| pleckstrin homology domain-containing family... 77 2e-12 ref|XP_007221056.1| hypothetical protein PRUPE_ppa016061mg [Prun... 77 2e-12 ref|XP_007218569.1| hypothetical protein PRUPE_ppa013025mg [Prun... 77 2e-12 ref|XP_007215111.1| hypothetical protein PRUPE_ppa012881mg [Prun... 77 2e-12 gb|EXB58195.1| Pleckstrin-like domain-containing protein 1 [Moru... 77 2e-12 ref|XP_007016128.1| Pleckstrin [Theobroma cacao] gi|508786491|gb... 77 2e-12 ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-contai... 77 2e-12 ref|XP_002314112.1| Pleckstrin homology domain-containing protei... 77 2e-12 ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-contai... 77 2e-12 ref|XP_004307627.1| PREDICTED: pleckstrin homology domain-contai... 77 3e-12 ref|XP_004306250.1| PREDICTED: pleckstrin homology domain-contai... 77 3e-12 gb|EYU20025.1| hypothetical protein MIMGU_mgv1a014948mg [Mimulus... 76 4e-12 ref|XP_006399029.1| hypothetical protein EUTSA_v10015014mg [Eutr... 76 6e-12 ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycin... 75 7e-12 ref|XP_002526894.1| hypothetical protein RCOM_0593020 [Ricinus c... 75 7e-12 gb|EEC71831.1| hypothetical protein OsI_04488 [Oryza sativa Indi... 75 7e-12 >ref|XP_006435708.1| hypothetical protein CICLE_v10033015mg [Citrus clementina] gi|568865967|ref|XP_006486336.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Citrus sinensis] gi|557537904|gb|ESR48948.1| hypothetical protein CICLE_v10033015mg [Citrus clementina] Length = 143 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 143 >ref|XP_002312150.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] gi|550332562|gb|EEE89517.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] Length = 150 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR Sbjct: 112 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 150 >ref|XP_007009031.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] gi|508725944|gb|EOY17841.1| Pleckstrin (PH) domain superfamily protein [Theobroma cacao] Length = 143 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 143 >ref|XP_002269271.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] Length = 143 Score = 80.9 bits (198), Expect = 2e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 143 >ref|XP_002315163.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] gi|550330185|gb|EEF01334.2| pleckstrin homology domain-containing family protein [Populus trichocarpa] Length = 148 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSK 198 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYD K Sbjct: 106 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDGK 143 >ref|XP_007221056.1| hypothetical protein PRUPE_ppa016061mg [Prunus persica] gi|462417518|gb|EMJ22255.1| hypothetical protein PRUPE_ppa016061mg [Prunus persica] Length = 120 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSE+VDYDS + Sbjct: 74 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDSNK 112 >ref|XP_007218569.1| hypothetical protein PRUPE_ppa013025mg [Prunus persica] gi|462415031|gb|EMJ19768.1| hypothetical protein PRUPE_ppa013025mg [Prunus persica] Length = 143 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSE+VDYDS + Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDSNK 143 >ref|XP_007215111.1| hypothetical protein PRUPE_ppa012881mg [Prunus persica] gi|462411261|gb|EMJ16310.1| hypothetical protein PRUPE_ppa012881mg [Prunus persica] Length = 151 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTDSE+VDYDS + Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDSNK 143 >gb|EXB58195.1| Pleckstrin-like domain-containing protein 1 [Morus notabilis] Length = 143 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIAD+EKEKEDWINSIGRSIVQHSRSVTDSE+VDYDS++ Sbjct: 105 FIADTEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDSRK 143 >ref|XP_007016128.1| Pleckstrin [Theobroma cacao] gi|508786491|gb|EOY33747.1| Pleckstrin [Theobroma cacao] Length = 145 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSK 198 F+AD+EKEKEDWINSIGRSIVQHSRSVTDSE+VDYDSK Sbjct: 106 FVADTEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDSK 143 >ref|XP_003519389.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Glycine max] Length = 148 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDS 201 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDS Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDS 141 >ref|XP_002314112.1| Pleckstrin homology domain-containing protein 1 [Populus trichocarpa] gi|222850520|gb|EEE88067.1| Pleckstrin homology domain-containing protein 1 [Populus trichocarpa] Length = 143 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKE+WINSIGRSIVQHSRSVTDSEIVDYDS R Sbjct: 105 FIADSEKEKEEWINSIGRSIVQHSRSVTDSEIVDYDSTR 143 >ref|XP_002279631.1| PREDICTED: pleckstrin homology domain-containing protein 1 [Vitis vinifera] gi|147863745|emb|CAN83611.1| hypothetical protein VITISV_035612 [Vitis vinifera] Length = 143 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKE+WINSIGRSIVQHSRSVTDSE+VDYD KR Sbjct: 105 FIADSEKEKEEWINSIGRSIVQHSRSVTDSEVVDYDCKR 143 >ref|XP_004307627.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 144 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDS 201 FIADSEKEKEDWINSIGRSIVQHSRSVTDSE+VDYDS Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDS 141 >ref|XP_004306250.1| PREDICTED: pleckstrin homology domain-containing protein 1-like [Fragaria vesca subsp. vesca] Length = 182 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDS 201 FIADSEKEKEDWINSIGRSIVQHSRSVTDSE+VDYDS Sbjct: 143 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEVVDYDS 179 >gb|EYU20025.1| hypothetical protein MIMGU_mgv1a014948mg [Mimulus guttatus] Length = 173 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/39 (89%), Positives = 39/39 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKEDWINSIGRSIVQHSRSVTD+EI+DYDS++ Sbjct: 135 FIADSEKEKEDWINSIGRSIVQHSRSVTDNEILDYDSRK 173 >ref|XP_006399029.1| hypothetical protein EUTSA_v10015014mg [Eutrema salsugineum] gi|557100119|gb|ESQ40482.1| hypothetical protein EUTSA_v10015014mg [Eutrema salsugineum] Length = 129 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADS+KEKEDWINSIGR IVQHSRSVTDSEIVDYD KR Sbjct: 91 FIADSDKEKEDWINSIGRCIVQHSRSVTDSEIVDYDHKR 129 >ref|NP_001235232.1| uncharacterized protein LOC100527890 [Glycine max] gi|571505514|ref|XP_006595539.1| PREDICTED: uncharacterized protein LOC100527890 isoform X1 [Glycine max] gi|571505517|ref|XP_006595540.1| PREDICTED: uncharacterized protein LOC100527890 isoform X2 [Glycine max] gi|255633474|gb|ACU17095.1| unknown [Glycine max] Length = 146 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDS 201 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEI+DYD+ Sbjct: 105 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIIDYDN 141 >ref|XP_002526894.1| hypothetical protein RCOM_0593020 [Ricinus communis] gi|223533793|gb|EEF35525.1| hypothetical protein RCOM_0593020 [Ricinus communis] Length = 300 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYD 204 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYD Sbjct: 56 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYD 91 >gb|EEC71831.1| hypothetical protein OsI_04488 [Oryza sativa Indica Group] Length = 142 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 311 FIADSEKEKEDWINSIGRSIVQHSRSVTDSEIVDYDSKR 195 FIADSEKEKE+WINSIGRSIVQHSRSVTD+EIVDYDS R Sbjct: 93 FIADSEKEKEEWINSIGRSIVQHSRSVTDAEIVDYDSGR 131