BLASTX nr result
ID: Paeonia25_contig00019568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00019568 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006581921.1| PREDICTED: HEAT repeat-containing protein 6-... 68 2e-09 ref|XP_006581920.1| PREDICTED: HEAT repeat-containing protein 6-... 68 2e-09 ref|XP_004502055.1| PREDICTED: HEAT repeat-containing protein 6-... 67 2e-09 ref|XP_003601433.1| HEAT repeat-containing protein [Medicago tru... 67 3e-09 emb|CBI34631.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002271527.1| PREDICTED: uncharacterized protein LOC100265... 64 2e-08 ref|XP_007210423.1| hypothetical protein PRUPE_ppa000436mg [Prun... 62 6e-08 ref|XP_007133296.1| hypothetical protein PHAVU_011G167600g [Phas... 60 2e-07 ref|XP_007133295.1| hypothetical protein PHAVU_011G167600g [Phas... 60 2e-07 ref|XP_004145966.1| PREDICTED: uncharacterized protein LOC101212... 58 1e-06 ref|XP_004162972.1| PREDICTED: uncharacterized LOC101212003 [Cuc... 57 2e-06 >ref|XP_006581921.1| PREDICTED: HEAT repeat-containing protein 6-like isoform X2 [Glycine max] Length = 1188 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 178 AASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 A +P VR WRTAFLT RDE LT P R S LL NLIFSHSD+L+ AA++LP Sbjct: 10 APTPLVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELP 61 >ref|XP_006581920.1| PREDICTED: HEAT repeat-containing protein 6-like isoform X1 [Glycine max] Length = 1256 Score = 67.8 bits (164), Expect = 2e-09 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = +1 Query: 178 AASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 A +P VR WRTAFLT RDE LT P R S LL NLIFSHSD+L+ AA++LP Sbjct: 10 APTPLVRLWRTAFLTLRDETLTVPPRNSTAQLLDNLIFSHSDALLSAAAELP 61 >ref|XP_004502055.1| PREDICTED: HEAT repeat-containing protein 6-like [Cicer arietinum] Length = 1182 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/52 (63%), Positives = 40/52 (76%) Frame = +1 Query: 178 AASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 A +P VR+WRTAFLT RDE LT+P RTS +L NLIFSHS +L+ AA +LP Sbjct: 11 APTPLVRSWRTAFLTLRDETLTNPPRTSTSQMLHNLIFSHSHTLLCAAPELP 62 >ref|XP_003601433.1| HEAT repeat-containing protein [Medicago truncatula] gi|355490481|gb|AES71684.1| HEAT repeat-containing protein [Medicago truncatula] Length = 1178 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = +1 Query: 175 MAASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 MA +P +R+WRTAFLT RDE LT+P R S +L NLIFSHS +L+ AA +LP Sbjct: 1 MAPTPLIRSWRTAFLTLRDESLTNPPRNSTSQMLHNLIFSHSHTLLSAAPELP 53 >emb|CBI34631.3| unnamed protein product [Vitis vinifera] Length = 1176 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = +1 Query: 181 ASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 +S +VR+WRTAFLT RDE L SP +++L+LLQ+L+FS+S SLI AA DLP Sbjct: 18 SSSAVRSWRTAFLTLRDETLASPPPSAVLNLLQHLLFSNSQSLIAAAPDLP 68 >ref|XP_002271527.1| PREDICTED: uncharacterized protein LOC100265120 [Vitis vinifera] Length = 1207 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = +1 Query: 181 ASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 +S +VR+WRTAFLT RDE L SP +++L+LLQ+L+FS+S SLI AA DLP Sbjct: 11 SSSAVRSWRTAFLTLRDETLASPPPSAVLNLLQHLLFSNSQSLIAAAPDLP 61 >ref|XP_007210423.1| hypothetical protein PRUPE_ppa000436mg [Prunus persica] gi|462406158|gb|EMJ11622.1| hypothetical protein PRUPE_ppa000436mg [Prunus persica] Length = 1185 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 178 AASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 ++S VR WRTAFLT RDE LT+PLRT + LL + IFSHS +L+ AA LP Sbjct: 10 SSSSPVRWWRTAFLTVRDETLTTPLRTPIPELLHHFIFSHSHTLLSAAPSLP 61 >ref|XP_007133296.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] gi|561006296|gb|ESW05290.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] Length = 590 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +1 Query: 178 AASPS--VRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 AA+P+ VR+WRTAFLT RDE LT P R S + LL NLI SHS L+ AA +LP Sbjct: 8 AAAPTSLVRSWRTAFLTLRDETLTIPSRNSNVQLLDNLILSHSKPLVSAAVELP 61 >ref|XP_007133295.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] gi|561006295|gb|ESW05289.1| hypothetical protein PHAVU_011G167600g [Phaseolus vulgaris] Length = 609 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +1 Query: 178 AASPS--VRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 AA+P+ VR+WRTAFLT RDE LT P R S + LL NLI SHS L+ AA +LP Sbjct: 8 AAAPTSLVRSWRTAFLTLRDETLTIPSRNSNVQLLDNLILSHSKPLVSAAVELP 61 >ref|XP_004145966.1| PREDICTED: uncharacterized protein LOC101212003 [Cucumis sativus] Length = 1190 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +1 Query: 178 AASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 ++S SVR+WRTAFLT RDE ++S TS+ LL + IFSHSDSLI AA LP Sbjct: 7 SSSSSVRSWRTAFLTLRDESISS--STSISQLLYDTIFSHSDSLIAAARYLP 56 >ref|XP_004162972.1| PREDICTED: uncharacterized LOC101212003 [Cucumis sativus] Length = 1190 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +1 Query: 178 AASPSVRTWRTAFLTPRDEKLTSPLRTSLLHLLQNLIFSHSDSLILAASDLP 333 ++S SVR+WRTAFLT RDE ++S TS+ LL + IFSHSDSLI AA LP Sbjct: 7 SSSYSVRSWRTAFLTLRDESISS--STSISQLLYDTIFSHSDSLIAAARYLP 56