BLASTX nr result
ID: Paeonia25_contig00019268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00019268 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66510.1| hypothetical protein VITISV_003620 [Vitis vinifera] 56 6e-06 >emb|CAN66510.1| hypothetical protein VITISV_003620 [Vitis vinifera] Length = 2197 Score = 55.8 bits (133), Expect = 6e-06 Identities = 42/124 (33%), Positives = 62/124 (50%), Gaps = 11/124 (8%) Frame = -1 Query: 359 EGGVRVPLHPLYCSFLKRVGLLPTQCSPNLHKVINGFVKLESRLPGNVHLVLDDLSHYYR 180 E G+RVP PL FL GL P+Q PN+ +V+ G + + + + L L ++ + Y Sbjct: 47 EAGLRVPFPPLIRRFLNFFGLPPSQIHPNVCRVLMGCLVINQK--AGLDLGLAEVLYCYS 104 Query: 179 LVKKRDK----YVLEIRNEVYPVTHLPDHHRGYGEYVVYLT-----GYFETHD--KCPRV 33 L KK +K Y+ I+ VT LPD +G+ V L+ G +E H + PRV Sbjct: 105 LKKKIEKRETYYLSTIKKPHSFVTDLPDSEKGWNNGYVVLSGRWEFGAWEEHQLWETPRV 164 Query: 32 AGRP 21 G P Sbjct: 165 LGNP 168