BLASTX nr result
ID: Paeonia25_contig00019236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00019236 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224947.1| hypothetical protein PRUPE_ppa021461mg [Prun... 57 2e-06 ref|XP_002510608.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_007224947.1| hypothetical protein PRUPE_ppa021461mg [Prunus persica] gi|462421883|gb|EMJ26146.1| hypothetical protein PRUPE_ppa021461mg [Prunus persica] Length = 418 Score = 57.4 bits (137), Expect = 2e-06 Identities = 40/102 (39%), Positives = 55/102 (53%), Gaps = 3/102 (2%) Frame = -1 Query: 299 GARCCGSSFGWLIIANEVEDNFLLHPFSRLQIQLPSQMTLPIFRVNNILTTDKSGGPLYI 120 GARC GSS GWL+I + + LL+PFSR QIQLP + P R+ L+ + + I Sbjct: 105 GARCLGSSHGWLVIMDSNGNPHLLNPFSRRQIQLP--LIWPFPRLTGDLSLESLRMCVSI 162 Query: 119 RKVILKSPPMSFFSTSQAADNCF-IVALYAS--HRLCFCRLG 3 K +L S P + DN F +V +Y S +L FC+ G Sbjct: 163 AKAVLSSDP--------SCDNNFAVVVIYDSLPSKLSFCKHG 196 >ref|XP_002510608.1| conserved hypothetical protein [Ricinus communis] gi|223551309|gb|EEF52795.1| conserved hypothetical protein [Ricinus communis] Length = 406 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 12/109 (11%) Frame = -1 Query: 293 RCCGSSFGWLIIANEVEDNFLLHPFSRLQIQLPSQMTLPIFRVNNILTTDKSGG------ 132 RCCGSS GWL++ + FLL+P ++ +I+LPS T P F + ++ Sbjct: 87 RCCGSSHGWLVMVEDTPSIFLLNPLTKARIELPSLSTFPYFPTEVVYENSRNINEYFNTK 146 Query: 131 ------PLYIRKVILKSPPMSFFSTSQAADNCFIVALYASHRLCFCRLG 3 YIRK I+ P ST A + ++ + FC+ G Sbjct: 147 AKLRIRETYIRKAIVSEDP----STGNFAVMAIYKTINSTENIAFCKSG 191