BLASTX nr result
ID: Paeonia25_contig00018659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00018659 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPQ57562.1| HbrB-domain-containing protein [Gloeophyllum trab... 58 6e-08 gb|ETW80467.1| hypothetical protein HETIRDRAFT_476087 [Heterobas... 60 4e-07 gb|EMD37787.1| hypothetical protein CERSUDRAFT_105686 [Ceriporio... 60 4e-07 gb|EPT02702.1| hypothetical protein FOMPIDRAFT_1022788 [Fomitops... 58 1e-06 ref|XP_007308141.1| HbrB-domain-containing protein [Stereum hirs... 58 1e-06 ref|XP_007317330.1| hypothetical protein SERLADRAFT_436965 [Serp... 58 1e-06 gb|EGN99644.1| hypothetical protein SERLA73DRAFT_72440 [Serpula ... 58 1e-06 ref|XP_007396774.1| hypothetical protein PHACADRAFT_257674 [Phan... 58 2e-06 >gb|EPQ57562.1| HbrB-domain-containing protein [Gloeophyllum trabeum ATCC 11539] Length = 592 Score = 58.2 bits (139), Expect(2) = 6e-08 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -2 Query: 328 FFWDTVLPYVEGALLPLQTDPILASLYGP-KTYKQAS 221 FFWD VLPYVEGALLPLQTDP+L LY P KT++ +S Sbjct: 304 FFWDQVLPYVEGALLPLQTDPLLLGLYRPAKTHRSSS 340 Score = 24.3 bits (51), Expect(2) = 6e-08 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = -1 Query: 185 PRLYARLMTPRDEGQ----GTNPGHPSQNPRLQQM 93 PRL ARL + E + G PG PRLQQM Sbjct: 373 PRLNARLEIMKREMKEGLFGGGPGENQIMPRLQQM 407 >gb|ETW80467.1| hypothetical protein HETIRDRAFT_476087 [Heterobasidion irregulare TC 32-1] Length = 432 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/37 (75%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -2 Query: 328 FFWDTVLPYVEGALLPLQTDPILASLY-GPKTYKQAS 221 FFWD VLPYVEG LLPLQTDPIL+SLY PKT++ +S Sbjct: 132 FFWDQVLPYVEGVLLPLQTDPILSSLYRTPKTHRNSS 168 >gb|EMD37787.1| hypothetical protein CERSUDRAFT_105686 [Ceriporiopsis subvermispora B] Length = 587 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = -2 Query: 328 FFWDTVLPYVEGALLPLQTDPILASLYG-PKTYK 230 FFWD VLPYVEGALLPLQTDP+L+SLY PKT+K Sbjct: 289 FFWDQVLPYVEGALLPLQTDPLLSSLYRVPKTHK 322 >gb|EPT02702.1| hypothetical protein FOMPIDRAFT_1022788 [Fomitopsis pinicola FP-58527 SS1] Length = 444 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -2 Query: 328 FFWDTVLPYVEGALLPLQTDPILASLYG-PKTYKQAS 221 FFWD VLPYVEGALLPLQTDP+L+SLY PK +K S Sbjct: 161 FFWDQVLPYVEGALLPLQTDPLLSSLYRVPKGHKPTS 197 >ref|XP_007308141.1| HbrB-domain-containing protein [Stereum hirsutum FP-91666 SS1] gi|389741785|gb|EIM82973.1| HbrB-domain-containing protein [Stereum hirsutum FP-91666 SS1] Length = 596 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 32/37 (86%), Gaps = 1/37 (2%) Frame = -2 Query: 328 FFWDTVLPYVEGALLPLQTDPILASLY-GPKTYKQAS 221 FFWD VLPYVEG LLPLQT+PILA+LY PKT++ +S Sbjct: 259 FFWDQVLPYVEGVLLPLQTEPILATLYRTPKTHRNSS 295 >ref|XP_007317330.1| hypothetical protein SERLADRAFT_436965 [Serpula lacrymans var. lacrymans S7.9] gi|336384060|gb|EGO25208.1| hypothetical protein SERLADRAFT_436965 [Serpula lacrymans var. lacrymans S7.9] Length = 816 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 331 SFFWDTVLPYVEGALLPLQTDPILASLY-GPKTYKQAS 221 SFFWD +LPYVEG LLPLQTDP+L+SLY PK ++ +S Sbjct: 408 SFFWDQILPYVEGVLLPLQTDPLLSSLYRNPKQHRTSS 445 >gb|EGN99644.1| hypothetical protein SERLA73DRAFT_72440 [Serpula lacrymans var. lacrymans S7.3] Length = 829 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 331 SFFWDTVLPYVEGALLPLQTDPILASLY-GPKTYKQAS 221 SFFWD +LPYVEG LLPLQTDP+L+SLY PK ++ +S Sbjct: 421 SFFWDQILPYVEGVLLPLQTDPLLSSLYRNPKQHRTSS 458 >ref|XP_007396774.1| hypothetical protein PHACADRAFT_257674 [Phanerochaete carnosa HHB-10118-sp] gi|409044591|gb|EKM54072.1| hypothetical protein PHACADRAFT_257674 [Phanerochaete carnosa HHB-10118-sp] Length = 538 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/37 (75%), Positives = 30/37 (81%), Gaps = 1/37 (2%) Frame = -2 Query: 328 FFWDTVLPYVEGALLPLQTDPILASLYG-PKTYKQAS 221 FFWD VLPYVEGALLPLQTDP+L SLY PK +K S Sbjct: 268 FFWDEVLPYVEGALLPLQTDPLLLSLYKIPKPHKPTS 304