BLASTX nr result
ID: Paeonia25_contig00018294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00018294 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317074.2| FAD-binding domain-containing family protein... 47 6e-08 ref|XP_002299010.2| hypothetical protein POPTR_0001s46360g [Popu... 49 1e-07 ref|XP_002300550.2| hypothetical protein POPTR_0001s46390g [Popu... 47 1e-07 ref|XP_002529891.1| Reticuline oxidase precursor, putative [Rici... 47 3e-07 ref|XP_002529892.1| Reticuline oxidase precursor, putative [Rici... 49 1e-06 ref|XP_002317086.1| FAD-binding domain-containing family protein... 44 2e-06 ref|NP_193812.1| FAD-binding and BBE domain-containing protein [... 41 2e-06 ref|XP_002317686.2| hypothetical protein POPTR_0011s15950g, part... 46 2e-06 ref|XP_002869926.1| FAD-binding domain-containing protein [Arabi... 42 3e-06 ref|XP_006427069.1| hypothetical protein CICLE_v10027503mg, part... 43 3e-06 ref|XP_002523153.1| Reticuline oxidase precursor, putative [Rici... 45 5e-06 ref|XP_002523154.1| Reticuline oxidase precursor, putative [Rici... 45 5e-06 ref|XP_006465585.1| PREDICTED: reticuline oxidase-like protein-l... 43 6e-06 ref|XP_003632449.1| PREDICTED: LOW QUALITY PROTEIN: reticuline o... 47 6e-06 >ref|XP_002317074.2| FAD-binding domain-containing family protein [Populus trichocarpa] gi|550328502|gb|EEE97686.2| FAD-binding domain-containing family protein [Populus trichocarpa] Length = 531 Score = 47.4 bits (111), Expect(2) = 6e-08 Identities = 19/30 (63%), Positives = 25/30 (83%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+ A+HE H+Q T +CAK HGL++RIR Sbjct: 79 PLAIVTALHESHVQATVVCAKSHGLQVRIR 108 Score = 35.0 bits (79), Expect(2) = 6e-08 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 Query: 227 P*IDNFLKCLHNHSSPANPISAAICTS 147 P +DNFLKCL ++S P+ PIS AI T+ Sbjct: 27 PSLDNFLKCLPSNSLPSYPISEAIYTT 53 >ref|XP_002299010.2| hypothetical protein POPTR_0001s46360g [Populus trichocarpa] gi|550350016|gb|EEE83815.2| hypothetical protein POPTR_0001s46360g [Populus trichocarpa] Length = 530 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AAMHE H+Q T ICAK +GL+IRIR Sbjct: 79 PLAIIAAMHESHVQATVICAKSNGLQIRIR 108 Score = 33.1 bits (74), Expect(2) = 1e-07 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAI 156 +DNFL+CL +HS P+ P+S A+ Sbjct: 29 LDNFLQCLPSHSHPSYPVSRAV 50 >ref|XP_002300550.2| hypothetical protein POPTR_0001s46390g [Populus trichocarpa] gi|550350018|gb|EEE85355.2| hypothetical protein POPTR_0001s46390g [Populus trichocarpa] Length = 532 Score = 47.0 bits (110), Expect(2) = 1e-07 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AA+HE H+Q T ICAK +GL+IRIR Sbjct: 78 PLAIIAAVHESHVQATVICAKSNGLQIRIR 107 Score = 34.3 bits (77), Expect(2) = 1e-07 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = -3 Query: 302 IKSSSQLVEFIVKAIIWALFTRLIPP*IDNFLKCLHNHSSPANPISAAI 156 +K+S +V A++ + +D FL+CL +HS P++PIS AI Sbjct: 1 MKASMSATLSVVSALLLLVSLAASDTVLDRFLQCLPSHSHPSHPISQAI 49 >ref|XP_002529891.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223530618|gb|EEF32494.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 524 Score = 46.6 bits (109), Expect(2) = 3e-07 Identities = 18/30 (60%), Positives = 25/30 (83%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+ A+HE H+Q T +CAK HG+++RIR Sbjct: 68 PLAIVTALHESHVQATVVCAKYHGMQLRIR 97 Score = 33.5 bits (75), Expect(2) = 3e-07 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAICT 150 +DNFL+CL NH P+ PI AI T Sbjct: 18 LDNFLQCLPNHVEPSKPILEAIYT 41 >ref|XP_002529892.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223530619|gb|EEF32495.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 419 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AA HE H+Q T ICAK HGL+IRIR Sbjct: 73 PLAIIAAKHESHVQATVICAKSHGLQIRIR 102 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 227 P*IDNFLKCLHNHSSPANPISAAICT 150 P +D FL+CL NH + PIS AI T Sbjct: 21 PVLDAFLQCLPNHIHHSIPISEAIYT 46 >ref|XP_002317086.1| FAD-binding domain-containing family protein [Populus trichocarpa] gi|222860151|gb|EEE97698.1| FAD-binding domain-containing family protein [Populus trichocarpa] Length = 534 Score = 43.9 bits (102), Expect(2) = 2e-06 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AA HE H+Q T IC+K GL+IRIR Sbjct: 74 PLAIIAAKHESHVQATIICSKKLGLQIRIR 103 Score = 33.5 bits (75), Expect(2) = 2e-06 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -3 Query: 218 DNFLKCLHNHSSPANPISAAICT 150 DNFL+CL +S P NPIS AI T Sbjct: 25 DNFLQCLTENSQPTNPISDAIHT 47 >ref|NP_193812.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] gi|5262220|emb|CAB45846.1| putative protein [Arabidopsis thaliana] gi|7268876|emb|CAB79080.1| putative protein [Arabidopsis thaliana] gi|29824399|gb|AAP04159.1| unknown protein [Arabidopsis thaliana] gi|30793853|gb|AAP40379.1| unknown protein [Arabidopsis thaliana] gi|110737219|dbj|BAF00557.1| hypothetical protein [Arabidopsis thaliana] gi|332658962|gb|AEE84362.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] Length = 528 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 24/29 (82%) Frame = -2 Query: 138 LAILAAMHEFHIQPTFICAKLHGLRIRIR 52 +AI+AA HE H+Q T +CAK +G++IRIR Sbjct: 77 IAIVAAKHESHVQATVVCAKSNGIQIRIR 105 Score = 36.2 bits (82), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -3 Query: 227 P*IDNFLKCLHNHSSPANPISAAICT 150 P I+NFL+CL N ++P NPI+ AI T Sbjct: 24 PNIENFLRCLRNRTNPKNPIAEAIYT 49 >ref|XP_002317686.2| hypothetical protein POPTR_0011s15950g, partial [Populus trichocarpa] gi|550328503|gb|EEE98298.2| hypothetical protein POPTR_0011s15950g, partial [Populus trichocarpa] Length = 541 Score = 46.2 bits (108), Expect(2) = 2e-06 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AA HE H+Q T ICAK +GL+IRIR Sbjct: 89 PLAIIAATHESHVQATVICAKSNGLQIRIR 118 Score = 30.8 bits (68), Expect(2) = 2e-06 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAI 156 +D FLKCL +HS + P+S+AI Sbjct: 39 LDRFLKCLPSHSDSSYPVSSAI 60 >ref|XP_002869926.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297315762|gb|EFH46185.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 529 Score = 42.0 bits (97), Expect(2) = 3e-06 Identities = 17/29 (58%), Positives = 25/29 (86%) Frame = -2 Query: 138 LAILAAMHEFHIQPTFICAKLHGLRIRIR 52 +AI+AA HE H+Q T +CAK++G++IRIR Sbjct: 77 IAIVAAKHESHVQATVVCAKVNGVQIRIR 105 Score = 34.7 bits (78), Expect(2) = 3e-06 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = -3 Query: 227 P*IDNFLKCLHNHSSPANPISAAICT 150 P +NFL+CL N +SP NPI+ A+ T Sbjct: 24 PNTENFLRCLRNRTSPKNPITEALYT 49 >ref|XP_006427069.1| hypothetical protein CICLE_v10027503mg, partial [Citrus clementina] gi|557529059|gb|ESR40309.1| hypothetical protein CICLE_v10027503mg, partial [Citrus clementina] Length = 505 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAIL A HE H+Q T ICAK GL +RIR Sbjct: 55 PLAILTAKHESHVQATVICAKQAGLELRIR 84 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAICTSIH 141 +++FL+CL H+ P+NPIS I T H Sbjct: 5 LESFLQCLPQHAQPSNPISDVIFTQNH 31 >ref|XP_002523153.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537560|gb|EEF39184.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 639 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AA HE H+Q T ICAK +G++IRIR Sbjct: 62 PLAIVAAKHESHVQATVICAKSNGMQIRIR 91 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAI 156 ++NFL+CL NH S + PIS AI Sbjct: 12 LENFLQCLPNHVSSSYPISEAI 33 >ref|XP_002523154.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537561|gb|EEF39185.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 526 Score = 45.1 bits (105), Expect(2) = 5e-06 Identities = 20/30 (66%), Positives = 25/30 (83%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAI+AA HE H+Q T ICAK +G++IRIR Sbjct: 79 PLAIVAAKHESHVQATVICAKSNGMQIRIR 108 Score = 30.8 bits (68), Expect(2) = 5e-06 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAI 156 ++NFL+CL NH S + PIS AI Sbjct: 29 LENFLQCLPNHVSSSYPISEAI 50 >ref|XP_006465585.1| PREDICTED: reticuline oxidase-like protein-like [Citrus sinensis] Length = 524 Score = 43.1 bits (100), Expect(2) = 6e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PLAIL A HE H+Q T ICAK GL +RIR Sbjct: 74 PLAILTAKHESHVQATVICAKQAGLELRIR 103 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAICTSIH 141 +++FL+CL H P+NPIS I T H Sbjct: 24 LESFLQCLPQHVQPSNPISDVIFTQNH 50 >ref|XP_003632449.1| PREDICTED: LOW QUALITY PROTEIN: reticuline oxidase-like protein-like [Vitis vinifera] Length = 443 Score = 47.0 bits (110), Expect(2) = 6e-06 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -2 Query: 141 PLAILAAMHEFHIQPTFICAKLHGLRIRIR 52 PL I+AA HE H+Q T ICAK HGL IRIR Sbjct: 78 PLVIVAAKHESHVQATVICAKTHGLEIRIR 107 Score = 28.5 bits (62), Expect(2) = 6e-06 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -3 Query: 221 IDNFLKCLHNHSSPANPISAAICT 150 + +FL+CL ++S P+ PIS AI T Sbjct: 28 VPDFLQCLSDYSLPSYPISEAIYT 51