BLASTX nr result
ID: Paeonia25_contig00017027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00017027 (840 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222668.1| ribosomal protein S18 [Anthriscus cerefolium... 132 2e-28 gb|ABY85567.1| ribosomal protein S18 [Silene sorensenis] 131 4e-28 ref|YP_086988.1| ribosomal protein S18 [Panax ginseng] gi|558603... 130 6e-28 ref|YP_004935574.1| ribosomal protein S18 (chloroplast) [Eleuthe... 130 6e-28 gb|ADD30024.1| ribosomal protein S18 [Staphylea colchica] 130 6e-28 ref|NP_054523.1| ribosomal protein S18 [Nicotiana tabacum] gi|28... 130 8e-28 ref|YP_008999957.1| ribosomal protein S18 (chloroplast) [Agroste... 130 8e-28 ref|YP_005296122.1| rps18 gene product (chloroplast) [Pentactina... 130 8e-28 gb|ABY85735.1| ribosomal protein S18 [Silene schafta] 130 8e-28 ref|YP_005089356.1| rps18 gene product (chloroplast) [Silene vul... 130 8e-28 gb|ADD30019.1| ribosomal protein S18 [Heuchera sanguinea] 129 1e-27 ref|YP_740139.1| ribosomal protein S18 [Daucus carota] gi|122233... 129 1e-27 ref|NP_054957.1| ribosomal protein S18 [Spinacia oleracea] gi|18... 129 1e-27 ref|YP_008963713.1| ribosomal protein S18 (chloroplast) [Liquida... 129 1e-27 gb|AGW04308.1| ribosomal protein S18 [Secamone afzelii] 129 2e-27 ref|YP_007353937.1| ribosomal protein S18 (chloroplast) [Tectona... 129 2e-27 gb|ADD30002.1| ribosomal protein S18 [Aucuba japonica] 129 2e-27 gb|ABY85777.1| ribosomal protein S18 [Silene atocioides] 129 2e-27 ref|YP_005089518.1| rps18 gene product (chloroplast) [Silene con... 129 2e-27 ref|YP_398351.1| ribosomal protein S18 [Lactuca sativa] gi|12224... 128 2e-27 >ref|YP_004222668.1| ribosomal protein S18 [Anthriscus cerefolium] gi|289645597|gb|ADD13660.1| ribosomal protein S18 [Anthriscus cerefolium] Length = 101 Score = 132 bits (331), Expect = 2e-28 Identities = 67/87 (77%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+N+R+ G RAR + Sbjct: 80 NEKQFE-----RTESNTRTAGLRARNK 101 >gb|ABY85567.1| ribosomal protein S18 [Silene sorensenis] Length = 101 Score = 131 bits (329), Expect = 4e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ FR +K+ Sbjct: 80 NEKQFE-----RNESTTRTNSFRTKKK 101 >ref|YP_086988.1| ribosomal protein S18 [Panax ginseng] gi|558603110|ref|YP_008815139.1| ribosomal protein S18 (chloroplast) [Schefflera delavayi] gi|563940301|ref|YP_008814878.1| ribosomal protein S18 (chloroplast) [Aralia undulata] gi|563940407|ref|YP_008815226.1| ribosomal protein S18 (chloroplast) [Kalopanax septemlobus] gi|62287418|sp|Q68RY4.1|RR18_PANGI RecName: Full=30S ribosomal protein S18, chloroplastic gi|51235335|gb|AAT98531.1| ribosomal protein S18 [Panax ginseng] gi|458599112|gb|AGG38978.1| ribosomal protein S18 (chloroplast) [Aralia undulata] gi|458599546|gb|AGG39239.1| ribosomal protein S18 (chloroplast) [Schefflera delavayi] gi|458599634|gb|AGG39326.1| ribosomal protein S18 (chloroplast) [Kalopanax septemlobus] gi|506444461|gb|AGM15023.1| ribosomal protein S18 (chloroplast) [Panax ginseng] gi|506444549|gb|AGM15109.1| ribosomal protein S18 (chloroplast) [Panax ginseng] gi|506444665|gb|AGM15195.1| ribosomal protein S18 (chloroplast) [Panax ginseng] Length = 101 Score = 130 bits (327), Expect = 6e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 N+KQ+E R E+ +R+ G RARK+ Sbjct: 80 NDKQFE-----RTESTARTAGLRARKK 101 >ref|YP_004935574.1| ribosomal protein S18 (chloroplast) [Eleutherococcus senticosus] gi|558602934|ref|YP_008814965.1| ribosomal protein S18 (chloroplast) [Brassaiopsis hainla] gi|558603022|ref|YP_008815052.1| ribosomal protein S18 (chloroplast) [Metapanax delavayi] gi|347448229|gb|AEO92641.1| ribosomal protein S18 (chloroplast) [Eleutherococcus senticosus] gi|458599214|gb|AGG39065.1| ribosomal protein S18 (chloroplast) [Brassaiopsis hainla] gi|458599393|gb|AGG39152.1| ribosomal protein S18 (chloroplast) [Metapanax delavayi] Length = 108 Score = 130 bits (327), Expect = 6e-28 Identities = 66/89 (74%), Positives = 77/89 (86%), Gaps = 2/89 (2%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASR--RAEANSRSGGFRARKR 627 N+KQ+E + R E+ +R+ G RARK+ Sbjct: 80 NDKQFENNDKQFERTESTARTAGLRARKK 108 >gb|ADD30024.1| ribosomal protein S18 [Staphylea colchica] Length = 101 Score = 130 bits (327), Expect = 6e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILS LPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSSLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R+E+ +R+ G R RK+ Sbjct: 80 NEKQFE-----RSESTTRTTGLRTRKK 101 >ref|NP_054523.1| ribosomal protein S18 [Nicotiana tabacum] gi|28261739|ref|NP_783254.1| ribosomal protein S18 [Atropa belladonna] gi|78102560|ref|YP_358701.1| ribosomal protein S18 [Nicotiana sylvestris] gi|81301590|ref|YP_398887.1| ribosomal protein S18 [Nicotiana tomentosiformis] gi|91209010|ref|YP_538870.1| ribosomal protein S18 [Solanum bulbocastanum] gi|108773152|ref|YP_635661.1| ribosomal protein S18 [Solanum tuberosum] gi|351653904|ref|YP_004891629.1| rps18 gene product (chloroplast) [Nicotiana undulata] gi|404474547|ref|YP_006666052.1| ribosomal protein S18 (chloroplast) [Capsicum annuum] gi|544163635|ref|YP_008563110.1| ribosomal protein S18 (chloroplast) [Solanum lycopersicum] gi|544170693|ref|AP_004950.1| ribosomal protein S18 (chloroplast) [Solanum lycopersicum] gi|62288969|sp|P69659.1|RR18_ATRBE RecName: Full=30S ribosomal protein S18, chloroplastic gi|62288970|sp|P69660.1|RR18_TOBAC RecName: Full=30S ribosomal protein S18, chloroplastic gi|122226851|sp|Q3C1K7.1|RR18_NICSY RecName: Full=30S ribosomal protein S18, chloroplastic gi|122233122|sp|Q33C10.1|RR18_NICTO RecName: Full=30S ribosomal protein S18, chloroplastic gi|122245043|sp|Q2MIG5.1|RR18_SOLBU RecName: Full=30S ribosomal protein S18, chloroplastic gi|122248444|sp|Q2MI78.1|RR18_SOLLC RecName: Full=30S ribosomal protein S18, chloroplastic gi|122248893|sp|Q2VEF6.1|RR18_SOLTU RecName: Full=30S ribosomal protein S18, chloroplastic gi|11851|emb|CAA77371.1| ribosomal protein S18 [Nicotiana tabacum] gi|20068353|emb|CAC88066.1| ribosomal protein S18 [Atropa belladonna] gi|77799587|dbj|BAE46676.1| ribosomal protein S18 [Nicotiana sylvestris] gi|80750949|dbj|BAE48025.1| ribosomal protein S18 [Nicotiana tomentosiformis] gi|82754648|gb|ABB90062.1| ribosomal protein S18 [Solanum tuberosum] gi|84371917|gb|ABC56235.1| ribosomal protein S18 [Solanum bulbocastanum] gi|84372005|gb|ABC56322.1| ribosomal protein S18 (chloroplast) [Solanum lycopersicum] gi|88656826|gb|ABD47079.1| ribosomal protein S18 [Solanum tuberosum] gi|89241693|emb|CAJ32415.1| ribosomal protein S18 [Solanum lycopersicum] gi|329124604|gb|AEB72161.1| ribosomal protein S18 (chloroplast) [Solanum tuberosum] gi|329124691|gb|AEB72247.1| ribosomal protein S18 (chloroplast) [Solanum tuberosum] gi|347453930|gb|AEO95588.1| ribosomal protein S18 (chloroplast) [Nicotiana undulata] gi|347454041|gb|AEO95698.1| ribosomal protein S18 [synthetic construct] gi|401065954|gb|AFP90798.1| ribosomal protein S18 (chloroplast) [Capsicum annuum] gi|478733664|gb|AGJ51275.1| ribosomal protein S18 (chloroplast) [Solanum carolinense] gi|225220|prf||1211235BB ribosomal protein S18 Length = 101 Score = 130 bits (326), Expect = 8e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITLAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ GF+AR + Sbjct: 80 NEKQFE-----RTESTARTTGFKARNK 101 >ref|YP_008999957.1| ribosomal protein S18 (chloroplast) [Agrostemma githago] gi|555944043|gb|AGZ17947.1| ribosomal protein S18 (chloroplast) [Agrostemma githago] Length = 101 Score = 130 bits (326), Expect = 8e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ FR +K+ Sbjct: 80 NEKQFE-----RNESTTRTYSFRTKKK 101 >ref|YP_005296122.1| rps18 gene product (chloroplast) [Pentactina rupicola] gi|371532645|gb|AEX31755.1| ribosomal protein S18 (chloroplast) [Pentactina rupicola] Length = 101 Score = 130 bits (326), Expect = 8e-28 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ G R RK+ Sbjct: 80 NEKQFE-----RTESTARTAGLRTRKK 101 >gb|ABY85735.1| ribosomal protein S18 [Silene schafta] Length = 101 Score = 130 bits (326), Expect = 8e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ FR +K+ Sbjct: 80 NEKQFE-----RNESTTRTYSFRTKKK 101 >ref|YP_005089356.1| rps18 gene product (chloroplast) [Silene vulgaris] gi|374249972|ref|YP_005089599.1| rps18 gene product (chloroplast) [Silene latifolia] gi|166235569|gb|ABY85483.1| ribosomal protein S18 [Silene samia] gi|166235613|gb|ABY85525.1| ribosomal protein S18 [Silene uniflora] gi|166235635|gb|ABY85546.1| ribosomal protein S18 [Silene zawadskii] gi|166235723|gb|ABY85630.1| ribosomal protein S18 [Silene latifolia] gi|166235767|gb|ABY85672.1| ribosomal protein S18 [Silene sordida] gi|166235811|gb|ABY85714.1| ribosomal protein S18 [Silene pseudoatocion] gi|329755543|gb|AEC04106.1| ribosomal protein S18 (chloroplast) [Silene latifolia] gi|329755708|gb|AEC04269.1| ribosomal protein S18 (chloroplast) [Silene vulgaris] Length = 101 Score = 130 bits (326), Expect = 8e-28 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ FR +K+ Sbjct: 80 NEKQFE-----RNESTTRTYSFRTKKK 101 >gb|ADD30019.1| ribosomal protein S18 [Heuchera sanguinea] Length = 101 Score = 129 bits (325), Expect = 1e-27 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ GFR R + Sbjct: 80 NEKQFE-----RTESTARTTGFRTRNK 101 >ref|YP_740139.1| ribosomal protein S18 [Daucus carota] gi|122233831|sp|Q0G9U0.1|RR18_DAUCA RecName: Full=30S ribosomal protein S18, chloroplastic gi|113200930|gb|ABI32446.1| ribosomal protein S18 [Daucus carota] gi|156574736|gb|ABU85200.1| ribosomal protein S18 [Anethum graveolens] Length = 101 Score = 129 bits (325), Expect = 1e-27 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ G RAR + Sbjct: 80 NEKQFE-----RTESTTRTAGLRARNK 101 >ref|NP_054957.1| ribosomal protein S18 [Spinacia oleracea] gi|18203259|sp|Q9M3K7.1|RR18_SPIOL RecName: Full=30S ribosomal protein S18, chloroplastic gi|7636130|emb|CAB88750.1| ribosomal protein S18 [Spinacia oleracea] Length = 101 Score = 129 bits (324), Expect = 1e-27 Identities = 65/79 (82%), Positives = 71/79 (89%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+TSAIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITSAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRS 603 NEKQ+E T S AN R+ Sbjct: 80 NEKQFERTESTTRTANFRT 98 >ref|YP_008963713.1| ribosomal protein S18 (chloroplast) [Liquidambar formosana] gi|290487272|gb|ADD30020.1| ribosomal protein S18 [Liquidambar styraciflua] gi|491650393|gb|AGL13453.1| ribosomal protein S18 (chloroplast) [Liquidambar formosana] Length = 101 Score = 129 bits (324), Expect = 1e-27 Identities = 66/87 (75%), Positives = 74/87 (85%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILS LPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSSLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ SR+ G R R + Sbjct: 80 NEKQFE-----RTESTSRTTGLRTRNK 101 >gb|AGW04308.1| ribosomal protein S18 [Secamone afzelii] Length = 103 Score = 129 bits (323), Expect = 2e-27 Identities = 66/87 (75%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T+AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITTAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ G R+R R Sbjct: 80 NEKQFE-----RNESTARTTGLRSRTR 101 >ref|YP_007353937.1| ribosomal protein S18 (chloroplast) [Tectona grandis] gi|438687626|emb|CCP47152.1| ribosomal protein S18 (chloroplast) [Tectona grandis] gi|438688310|emb|CCP47241.1| ribosomal protein S18 (chloroplast) [Tectona grandis] gi|438688434|emb|CCP47330.1| ribosomal protein S18 (chloroplast) [Tectona grandis] Length = 101 Score = 129 bits (323), Expect = 2e-27 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ G R RK+ Sbjct: 80 NEKQFE-----RIESTTRTTGLRTRKK 101 >gb|ADD30002.1| ribosomal protein S18 [Aucuba japonica] Length = 101 Score = 129 bits (323), Expect = 2e-27 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E RAE+ +R+ G R R + Sbjct: 80 NEKQFE-----RAESTARTTGLRTRNK 101 >gb|ABY85777.1| ribosomal protein S18 [Silene atocioides] Length = 101 Score = 129 bits (323), Expect = 2e-27 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ F+ +K+ Sbjct: 80 NEKQFE-----RNESTTRTYSFKTKKK 101 >ref|YP_005089518.1| rps18 gene product (chloroplast) [Silene conica] gi|575925652|ref|YP_009000037.1| ribosomal protein S18 (chloroplast) [Silene conoidea] gi|166235701|gb|ABY85609.1| ribosomal protein S18 [Silene conica] gi|329755461|gb|AEC04025.1| ribosomal protein S18 (chloroplast) [Silene conica] gi|555944124|gb|AGZ18027.1| ribosomal protein S18 (chloroplast) [Silene conoidea] Length = 98 Score = 129 bits (323), Expect = 2e-27 Identities = 65/87 (74%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQPGDRIDYRN+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQPGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E+T +R+ FR +K+ Sbjct: 80 NEKQFEST--------TRTSSFRTKKK 98 >ref|YP_398351.1| ribosomal protein S18 [Lactuca sativa] gi|122248966|sp|Q332V6.1|RR18_LACSA RecName: Full=30S ribosomal protein S18, chloroplastic gi|78675190|dbj|BAE47616.1| chloroplast 30S ribosomal protein S18 [Lactuca sativa] gi|88657005|gb|ABD47255.1| ribosomal protein S18 (chloroplast) [Lactuca sativa] Length = 101 Score = 128 bits (322), Expect = 2e-27 Identities = 66/87 (75%), Positives = 75/87 (86%) Frame = +1 Query: 367 PPIQPGDRIDYRNISLISRFVSEQGKILSRRINRLTLKQQRLVTSAIKQARILSLLPFLN 546 PPIQ GDRIDY+N+SLISRF+SEQGKILSRR+NRLTLKQQRL+T AIKQARILSLLPFLN Sbjct: 20 PPIQSGDRIDYKNMSLISRFISEQGKILSRRVNRLTLKQQRLITIAIKQARILSLLPFLN 79 Query: 547 NEKQYEATASRRAEANSRSGGFRARKR 627 NEKQ+E R E+ +R+ RARKR Sbjct: 80 NEKQFE-----RTESTTRTPSLRARKR 101