BLASTX nr result
ID: Paeonia25_contig00016922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016922 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006470844.1| PREDICTED: translation initiation factor eIF... 194 1e-47 ref|XP_006431425.1| hypothetical protein CICLE_v10001295mg [Citr... 194 1e-47 ref|XP_006431419.1| hypothetical protein CICLE_v10001295mg [Citr... 194 1e-47 ref|XP_006420748.1| hypothetical protein CICLE_v10005415mg [Citr... 194 1e-47 ref|XP_006420746.1| hypothetical protein CICLE_v10005415mg [Citr... 194 1e-47 ref|XP_007011105.1| NagB/RpiA/CoA transferase-like superfamily p... 193 2e-47 ref|XP_007011102.1| NagB/RpiA/CoA transferase-like superfamily p... 193 2e-47 ref|XP_002297747.2| eukaryotic translation initiation factor 2B ... 192 3e-47 ref|XP_002272876.2| PREDICTED: translation initiation factor eIF... 191 7e-47 ref|XP_006830361.1| hypothetical protein AMTR_s00116p00093870 [A... 191 1e-46 ref|XP_002304788.1| eukaryotic translation initiation factor 2B ... 191 1e-46 gb|EXB62651.1| Translation initiation factor eIF-2B subunit beta... 190 2e-46 ref|XP_007218071.1| hypothetical protein PRUPE_ppa006329mg [Prun... 189 3e-46 ref|XP_004307122.1| PREDICTED: translation initiation factor eIF... 188 6e-46 gb|EPS72914.1| hypothetical protein M569_01835 [Genlisea aurea] 184 1e-44 gb|EYU38271.1| hypothetical protein MIMGU_mgv1a007221mg [Mimulus... 182 3e-44 ref|XP_004165434.1| PREDICTED: translation initiation factor eIF... 181 7e-44 ref|XP_004143752.1| PREDICTED: translation initiation factor eIF... 181 7e-44 gb|AAD52847.2|AF137288_1 putative translation initiation factor ... 181 9e-44 ref|XP_006350997.1| PREDICTED: translation initiation factor eIF... 179 4e-43 >ref|XP_006470844.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X1 [Citrus sinensis] gi|568833313|ref|XP_006470845.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X2 [Citrus sinensis] gi|568833315|ref|XP_006470846.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X3 [Citrus sinensis] gi|568833317|ref|XP_006470847.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X4 [Citrus sinensis] Length = 417 Score = 194 bits (492), Expect = 1e-47 Identities = 89/103 (86%), Positives = 97/103 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGSGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 AFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006431425.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533547|gb|ESR44665.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] Length = 419 Score = 194 bits (492), Expect = 1e-47 Identities = 89/103 (86%), Positives = 97/103 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 312 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGSGSPLLHVVNP 371 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 372 AFDYVPPKLVSLFITDAGGHNPSYMYRLIADYYSADDLVVQRR 414 >ref|XP_006431419.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|567877723|ref|XP_006431420.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|567877729|ref|XP_006431423.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|567877731|ref|XP_006431424.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533541|gb|ESR44659.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533542|gb|ESR44660.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533545|gb|ESR44663.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533546|gb|ESR44664.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] Length = 417 Score = 194 bits (492), Expect = 1e-47 Identities = 89/103 (86%), Positives = 97/103 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGSGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 AFDYVPPKLVSLFITDAGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006420748.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|567855259|ref|XP_006420749.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522621|gb|ESR33988.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522622|gb|ESR33989.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] Length = 417 Score = 194 bits (492), Expect = 1e-47 Identities = 89/103 (86%), Positives = 97/103 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGSGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 AFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006420746.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522619|gb|ESR33986.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] Length = 375 Score = 194 bits (492), Expect = 1e-47 Identities = 89/103 (86%), Positives = 97/103 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 268 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGSGSPLLHVVNP 327 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 328 AFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 370 >ref|XP_007011105.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] gi|590569574|ref|XP_007011106.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] gi|508728018|gb|EOY19915.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] gi|508728019|gb|EOY19916.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] Length = 322 Score = 193 bits (490), Expect = 2e-47 Identities = 88/103 (85%), Positives = 96/103 (93%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 215 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGNGAPLLHVVNP 274 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 FDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 275 TFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 317 >ref|XP_007011102.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|590569565|ref|XP_007011103.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|590569568|ref|XP_007011104.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|508728015|gb|EOY19912.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|508728016|gb|EOY19913.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|508728017|gb|EOY19914.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] Length = 417 Score = 193 bits (490), Expect = 2e-47 Identities = 88/103 (85%), Positives = 96/103 (93%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGNGAPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 FDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 TFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_002297747.2| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] gi|550346654|gb|EEE82552.2| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] Length = 419 Score = 192 bits (489), Expect = 3e-47 Identities = 88/104 (84%), Positives = 98/104 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDC+DFG+G G PLLHV NP Sbjct: 312 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGSGTGSPLLHVVNP 371 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRKL 49 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR++ Sbjct: 372 AFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRRI 415 >ref|XP_002272876.2| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform 1 [Vitis vinifera] gi|359487220|ref|XP_003633538.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform 2 [Vitis vinifera] gi|297742689|emb|CBI35142.3| unnamed protein product [Vitis vinifera] Length = 417 Score = 191 bits (486), Expect = 7e-47 Identities = 87/103 (84%), Positives = 97/103 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AG+HKLCPLYPHNPE LLN+++S SELLDFGEFSDCMDFG+G G PLLHV NP Sbjct: 310 AVPFVVLAGTHKLCPLYPHNPEVLLNELKSPSELLDFGEFSDCMDFGSGNGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 AFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006830361.1| hypothetical protein AMTR_s00116p00093870 [Amborella trichopoda] gi|548836631|gb|ERM97777.1| hypothetical protein AMTR_s00116p00093870 [Amborella trichopoda] Length = 417 Score = 191 bits (484), Expect = 1e-46 Identities = 86/103 (83%), Positives = 96/103 (93%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVVVAGSHKLCPLYPHNPE LLND++S S+LLDFGEFSDCMD+G+G G PLLHV NP Sbjct: 309 AVPFVVVAGSHKLCPLYPHNPEVLLNDLKSPSDLLDFGEFSDCMDYGSGNGAPLLHVVNP 368 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 FDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQ++ Sbjct: 369 TFDYVPPQLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQQQ 411 >ref|XP_002304788.1| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] gi|222842220|gb|EEE79767.1| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] Length = 420 Score = 191 bits (484), Expect = 1e-46 Identities = 87/104 (83%), Positives = 98/104 (94%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDC+DFG+G G PLLHV NP Sbjct: 313 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGSGTGSPLLHVVNP 372 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRKL 49 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVV+R++ Sbjct: 373 AFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVRRRV 416 >gb|EXB62651.1| Translation initiation factor eIF-2B subunit beta [Morus notabilis] Length = 417 Score = 190 bits (482), Expect = 2e-46 Identities = 87/103 (84%), Positives = 96/103 (93%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFS+CMDFG+G G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSECMDFGSGTGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 FDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 TFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_007218071.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] gi|596000490|ref|XP_007218072.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] gi|462414533|gb|EMJ19270.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] gi|462414534|gb|EMJ19271.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] Length = 417 Score = 189 bits (480), Expect = 3e-46 Identities = 87/103 (84%), Positives = 95/103 (92%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG+G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGTASPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 FDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 370 TFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_004307122.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Fragaria vesca subsp. vesca] Length = 416 Score = 188 bits (478), Expect = 6e-46 Identities = 87/103 (84%), Positives = 95/103 (92%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDF +G G PLLHV NP Sbjct: 309 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFRSGTGSPLLHVVNP 368 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 FDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 369 TFDYVPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 411 >gb|EPS72914.1| hypothetical protein M569_01835 [Genlisea aurea] Length = 420 Score = 184 bits (467), Expect = 1e-44 Identities = 83/101 (82%), Positives = 94/101 (93%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AG+HKLCPLYPHNPE LLN++RS SE+LDFGEFSDC+DFG G G PL+HV NP Sbjct: 310 AVPFVVLAGTHKLCPLYPHNPEVLLNELRSPSEVLDFGEFSDCLDFGVGSGSPLVHVLNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQ 58 AFDYVPP+LVSLFITD GGHNPSY+YRLIADYYS+DDLV+Q Sbjct: 370 AFDYVPPDLVSLFITDTGGHNPSYMYRLIADYYSADDLVLQ 410 >gb|EYU38271.1| hypothetical protein MIMGU_mgv1a007221mg [Mimulus guttatus] Length = 414 Score = 182 bits (463), Expect = 3e-44 Identities = 83/103 (80%), Positives = 93/103 (90%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AG HKLCP YPHNPE LLN+++S SELLDFGEFSDC+DF +G G PLLHV NP Sbjct: 309 AVPFVVLAGVHKLCPQYPHNPEVLLNELKSPSELLDFGEFSDCLDFASGSGSPLLHVVNP 368 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP LVSLFITD GGHNPSY+YRLIADYYS+DD+VV+RK Sbjct: 369 AFDYVPPNLVSLFITDTGGHNPSYMYRLIADYYSADDVVVKRK 411 >ref|XP_004165434.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Cucumis sativus] Length = 275 Score = 181 bits (460), Expect = 7e-44 Identities = 84/102 (82%), Positives = 91/102 (89%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG G PLLHV NP Sbjct: 169 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGTCTGSPLLHVVNP 228 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQR 55 FDYVPP LVSLFITD GGHN SY+YRLIADYYS+DDLV++R Sbjct: 229 TFDYVPPSLVSLFITDTGGHNSSYMYRLIADYYSADDLVIKR 270 >ref|XP_004143752.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Cucumis sativus] Length = 416 Score = 181 bits (460), Expect = 7e-44 Identities = 84/102 (82%), Positives = 91/102 (89%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AGSHKLCPLYPHNPE LLN++RS SELLDFGEFSDCMDFG G PLLHV NP Sbjct: 310 AVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGTCTGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQR 55 FDYVPP LVSLFITD GGHN SY+YRLIADYYS+DDLV++R Sbjct: 370 TFDYVPPSLVSLFITDTGGHNSSYMYRLIADYYSADDLVIKR 411 >gb|AAD52847.2|AF137288_1 putative translation initiation factor 2B beta subunit [Nicotiana tabacum] Length = 415 Score = 181 bits (459), Expect = 9e-44 Identities = 81/102 (79%), Positives = 93/102 (91%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AG+HKLCPLYPHNPE LLN+++S +ELLDFGEFSDC+DFG+ G PLLHV NP Sbjct: 310 AVPFVVLAGTHKLCPLYPHNPEVLLNELKSPAELLDFGEFSDCLDFGSSSGSPLLHVVNP 369 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQR 55 AFDYVPP LVSLFITD GGHNPSY+YRLIADYYS+DD VV++ Sbjct: 370 AFDYVPPNLVSLFITDTGGHNPSYMYRLIADYYSADDFVVKQ 411 >ref|XP_006350997.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Solanum tuberosum] Length = 414 Score = 179 bits (454), Expect = 4e-43 Identities = 80/103 (77%), Positives = 94/103 (91%) Frame = -1 Query: 360 AVPFVVVAGSHKLCPLYPHNPETLLNDMRSSSELLDFGEFSDCMDFGNGGGVPLLHVSNP 181 AVPFVV+AG+HKLCPLYPHNPE LLN+++S +ELLDFGEFSDC+DFG+ G PLLHV NP Sbjct: 307 AVPFVVLAGTHKLCPLYPHNPEVLLNELKSPAELLDFGEFSDCLDFGSSSGSPLLHVVNP 366 Query: 180 AFDYVPPELVSLFITDIGGHNPSYIYRLIADYYSSDDLVVQRK 52 AFDYVPP LVSLFITD GGHN S++YRLIADYYS+DD+VV++K Sbjct: 367 AFDYVPPNLVSLFITDTGGHNASFMYRLIADYYSADDIVVKQK 409