BLASTX nr result
ID: Paeonia25_contig00016872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016872 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW51558.1| glycerol dehydrogenase [Trametes versicolor FP-10... 56 8e-07 ref|XP_007370603.1| glycerol dehydrogenase [Dichomitus squalens ... 58 2e-06 ref|XP_003035676.1| hypothetical protein SCHCODRAFT_255865 [Schi... 54 3e-06 >gb|EIW51558.1| glycerol dehydrogenase [Trametes versicolor FP-101664 SS1] Length = 395 Score = 56.2 bits (134), Expect(2) = 8e-07 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = -3 Query: 145 DVLATNVEARQFCNNLNLGGSPSIKVSAVICQKCKEILSMYGGMAYEA 2 D +ATNVEAR + N GG +VSA ICQKC+EIL YG AYEA Sbjct: 178 DAIATNVEARSVRFSTNFGGGLPTEVSAAICQKCEEILFSYGKQAYEA 225 Score = 22.3 bits (46), Expect(2) = 8e-07 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 198 NIVCVDTSIVAHAP 157 NIV VDT++++ AP Sbjct: 155 NIVLVDTTVISKAP 168 >ref|XP_007370603.1| glycerol dehydrogenase [Dichomitus squalens LYAD-421 SS1] gi|395324206|gb|EJF56651.1| glycerol dehydrogenase [Dichomitus squalens LYAD-421 SS1] Length = 376 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 145 DVLATNVEARQFCNNLNLGGSPSIKVSAVICQKCKEILSMYGGMAYEA 2 D +ATNVEAR+ N+ N GG +VS+ IC+KC+EIL YG AYEA Sbjct: 178 DAIATNVEARRCKNSTNFGGGLQTEVSSAICEKCEEILFKYGKQAYEA 225 >ref|XP_003035676.1| hypothetical protein SCHCODRAFT_255865 [Schizophyllum commune H4-8] gi|300109372|gb|EFJ00774.1| hypothetical protein SCHCODRAFT_255865 [Schizophyllum commune H4-8] Length = 407 Score = 53.9 bits (128), Expect(2) = 3e-06 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = -3 Query: 145 DVLATNVEARQFCNNLNLGGSPSIKVSAVICQKCKEILSMYGGMAYEA 2 D LATNVEA++ N+ N GG +S ICQKC+EIL +G AYEA Sbjct: 176 DALATNVEAKRARNSPNFGGGMPALISTAICQKCEEILFKHGKQAYEA 223 Score = 22.7 bits (47), Expect(2) = 3e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 195 IVCVDTSIVAHAP 157 +V VDTSIVA AP Sbjct: 154 LVIVDTSIVARAP 166