BLASTX nr result
ID: Paeonia25_contig00016811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016811 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20472.3| unnamed protein product [Vitis vinifera] 82 9e-14 ref|XP_002269409.1| PREDICTED: 60S ribosomal protein L8 [Vitis v... 82 9e-14 ref|XP_002283149.1| PREDICTED: 60S ribosomal protein L8 [Vitis v... 82 9e-14 ref|XP_002515688.1| 60S ribosomal protein L8, putative [Ricinus ... 82 1e-13 gb|EYU19189.1| hypothetical protein MIMGU_mgv1a012096mg [Mimulus... 81 2e-13 gb|EXC23174.1| 60S ribosomal protein L8 [Morus notabilis] 81 2e-13 ref|XP_002526326.1| 60S ribosomal protein L8, putative [Ricinus ... 81 2e-13 ref|XP_006362915.1| PREDICTED: 60S ribosomal protein L8-like [So... 81 2e-13 gb|ABB55374.1| ribosomal protein L2-like [Solanum tuberosum] 81 2e-13 ref|NP_001234115.1| 60S ribosomal protein L8 [Solanum lycopersic... 81 2e-13 ref|XP_002281476.1| PREDICTED: 60S ribosomal protein L8 [Vitis v... 81 2e-13 ref|XP_006654068.1| PREDICTED: 60S ribosomal protein L8-like [Or... 80 3e-13 ref|XP_006363509.1| PREDICTED: 60S ribosomal protein L8-like [So... 80 3e-13 ref|XP_006360110.1| PREDICTED: 60S ribosomal protein L8-like [So... 80 3e-13 ref|XP_004956031.1| PREDICTED: 60S ribosomal protein L8-like [Se... 80 3e-13 gb|EMT07940.1| 60S ribosomal protein L8 [Aegilops tauschii] 80 3e-13 gb|EMT02250.1| 60S ribosomal protein L8 [Aegilops tauschii] 80 3e-13 gb|EMS54696.1| 60S ribosomal protein L8 [Triticum urartu] 80 3e-13 ref|XP_004251488.1| PREDICTED: 60S ribosomal protein L8-like [So... 80 3e-13 ref|XP_004244173.1| PREDICTED: 60S ribosomal protein L8-like [So... 80 3e-13 >emb|CBI20472.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 82.0 bits (201), Expect = 9e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI++SHNP+NG SRI LP GAKKI+P GCRAMV QV GGGRTEK Sbjct: 51 DYAIVVSHNPDNGTSRIKLPSGAKKIIPSGCRAMVGQVAGGGRTEK 96 >ref|XP_002269409.1| PREDICTED: 60S ribosomal protein L8 [Vitis vinifera] Length = 260 Score = 82.0 bits (201), Expect = 9e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI++SHNP+NG SRI LP GAKKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVVSHNPDNGTSRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|XP_002283149.1| PREDICTED: 60S ribosomal protein L8 [Vitis vinifera] Length = 260 Score = 82.0 bits (201), Expect = 9e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI++SHNP+NG SRI LP GAKKI+P GCRAMV QV GGGRTEK Sbjct: 132 DYAIVVSHNPDNGTSRIKLPSGAKKIIPSGCRAMVGQVAGGGRTEK 177 >ref|XP_002515688.1| 60S ribosomal protein L8, putative [Ricinus communis] gi|223545125|gb|EEF46635.1| 60S ribosomal protein L8, putative [Ricinus communis] Length = 261 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +RI LP GAKKIVP GCRAMV QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRIKLPSGAKKIVPSGCRAMVGQVAGGGRTEK 177 >gb|EYU19189.1| hypothetical protein MIMGU_mgv1a012096mg [Mimulus guttatus] Length = 261 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +R+ LP GAKKIVP GCRAMV QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRVKLPSGAKKIVPSGCRAMVGQVAGGGRTEK 177 >gb|EXC23174.1| 60S ribosomal protein L8 [Morus notabilis] Length = 261 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYA++ISHNP+NG +RI LP GAKKIVP GCRAMV QV GGGRTEK Sbjct: 132 DYAVVISHNPDNGTTRIKLPSGAKKIVPSGCRAMVGQVAGGGRTEK 177 >ref|XP_002526326.1| 60S ribosomal protein L8, putative [Ricinus communis] gi|223534353|gb|EEF36062.1| 60S ribosomal protein L8, putative [Ricinus communis] Length = 261 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +R+ LP GAKKIVP GCRAMV QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRVKLPSGAKKIVPSGCRAMVGQVAGGGRTEK 177 >ref|XP_006362915.1| PREDICTED: 60S ribosomal protein L8-like [Solanum tuberosum] Length = 260 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +R+ LP GAKKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRVKLPSGAKKIVPSGCRAMIGQVAGGGRTEK 177 >gb|ABB55374.1| ribosomal protein L2-like [Solanum tuberosum] Length = 261 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +R+ LP GAKKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRVKLPSGAKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|NP_001234115.1| 60S ribosomal protein L8 [Solanum lycopersicum] gi|266944|sp|P29766.1|RL8_SOLLC RecName: Full=60S ribosomal protein L8; AltName: Full=L2; AltName: Full=Ribosomal protein TL2 gi|19343|emb|CAA45863.1| ribosomal protein L2 [Solanum lycopersicum] Length = 260 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +R+ LP GAKKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRVKLPSGAKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|XP_002281476.1| PREDICTED: 60S ribosomal protein L8 [Vitis vinifera] gi|147864499|emb|CAN80494.1| hypothetical protein VITISV_021173 [Vitis vinifera] Length = 260 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DY+I++SHNP+NG SRI LP GAKKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYSIVVSHNPDNGTSRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|XP_006654068.1| PREDICTED: 60S ribosomal protein L8-like [Oryza brachyantha] Length = 261 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG SRI LP GAKKIVP CRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEK 177 >ref|XP_006363509.1| PREDICTED: 60S ribosomal protein L8-like [Solanum tuberosum] Length = 260 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +RI LP G+KKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|XP_006360110.1| PREDICTED: 60S ribosomal protein L8-like [Solanum tuberosum] Length = 260 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +RI LP G+KKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|XP_004956031.1| PREDICTED: 60S ribosomal protein L8-like [Setaria italica] gi|514753084|ref|XP_004962712.1| PREDICTED: 60S ribosomal protein L8-like [Setaria italica] Length = 261 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG SRI LP GAKKIVP CRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEK 177 >gb|EMT07940.1| 60S ribosomal protein L8 [Aegilops tauschii] Length = 261 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG SRI LP GAKKIVP CRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEK 177 >gb|EMT02250.1| 60S ribosomal protein L8 [Aegilops tauschii] Length = 207 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG SRI LP GAKKIVP CRAM+ QV GGGRTEK Sbjct: 78 DYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEK 123 >gb|EMS54696.1| 60S ribosomal protein L8 [Triticum urartu] Length = 270 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG SRI LP GAKKIVP CRAM+ QV GGGRTEK Sbjct: 141 DYAIVISHNPDNGTSRIKLPSGAKKIVPSSCRAMIGQVAGGGRTEK 186 >ref|XP_004251488.1| PREDICTED: 60S ribosomal protein L8-like [Solanum lycopersicum] Length = 260 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +RI LP G+KKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEK 177 >ref|XP_004244173.1| PREDICTED: 60S ribosomal protein L8-like [Solanum lycopersicum] Length = 260 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 138 DYAIIISHNPNNGASRINLPFGAKKIVPGGCRAMVSQVVGGGRTEK 1 DYAI+ISHNP+NG +RI LP G+KKIVP GCRAM+ QV GGGRTEK Sbjct: 132 DYAIVISHNPDNGTTRIKLPSGSKKIVPSGCRAMIGQVAGGGRTEK 177