BLASTX nr result
ID: Paeonia25_contig00016635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016635 (473 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW58488.1| hypothetical protein TRAVEDRAFT_124042 [Trametes ... 70 4e-10 emb|CCM01334.1| predicted protein [Fibroporia radiculosa] 68 1e-09 ref|XP_007400968.1| hypothetical protein PHACADRAFT_188239 [Phan... 67 2e-09 gb|EPT02945.1| hypothetical protein FOMPIDRAFT_1028951 [Fomitops... 66 6e-09 gb|EMD39331.1| histidine kinase [Ceriporiopsis subvermispora B] 66 6e-09 ref|XP_007400950.1| hypothetical protein PHACADRAFT_152889 [Phan... 66 6e-09 ref|XP_002470995.1| hypothetical hybrid sensor histidine kinase ... 65 7e-09 ref|XP_002471647.1| hypothetical histidine kinase [Postia placen... 65 7e-09 ref|XP_007371002.1| hypothetical protein DICSQDRAFT_71854 [Dicho... 65 1e-08 gb|EPQ54871.1| hypothetical protein GLOTRDRAFT_111444 [Gloeophyl... 62 8e-08 gb|EPQ56119.1| hypothetical protein GLOTRDRAFT_74634 [Gloeophyll... 62 1e-07 gb|EUC59609.1| histidine kinase, putative [Rhizoctonia solani AG... 60 3e-07 emb|CCO28382.1| hypothetical protein BN14_02377 [Rhizoctonia sol... 60 3e-07 gb|ELU43511.1| putative histidine kinase [Rhizoctonia solani AG-... 60 3e-07 ref|XP_007400951.1| hypothetical protein PHACADRAFT_104556 [Phan... 60 3e-07 ref|XP_007310505.1| hypothetical protein STEHIDRAFT_172642 [Ster... 60 3e-07 gb|EUC53942.1| histidine kinase, putative [Rhizoctonia solani AG... 58 2e-06 gb|ETW78710.1| sensor histidine kinase-like protein [Heterobasid... 55 1e-05 ref|XP_007382577.1| hypothetical protein PUNSTDRAFT_125617 [Punc... 55 1e-05 >gb|EIW58488.1| hypothetical protein TRAVEDRAFT_124042 [Trametes versicolor FP-101664 SS1] Length = 1051 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRG 364 Q+EYLEAGVDHVLTKPVLEKSLKSMLV+ADERR+RG Sbjct: 1003 QQEYLEAGVDHVLTKPVLEKSLKSMLVIADERRRRG 1038 >emb|CCM01334.1| predicted protein [Fibroporia radiculosa] Length = 1085 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRG 364 Q+EYLEAG DHVLTKPVLEKSLKSML +ADERRKRG Sbjct: 1041 QQEYLEAGADHVLTKPVLEKSLKSMLAIADERRKRG 1076 >ref|XP_007400968.1| hypothetical protein PHACADRAFT_188239 [Phanerochaete carnosa HHB-10118-sp] gi|409041218|gb|EKM50704.1| hypothetical protein PHACADRAFT_188239 [Phanerochaete carnosa HHB-10118-sp] Length = 1134 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRGS 361 Q+EYL+AGVDHVLTKPVLEKSLK+ML +ADERRKRG+ Sbjct: 1087 QQEYLDAGVDHVLTKPVLEKSLKAMLAIADERRKRGT 1123 >gb|EPT02945.1| hypothetical protein FOMPIDRAFT_1028951 [Fomitopsis pinicola FP-58527 SS1] Length = 1020 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRGSA 358 Q+EYLE+G DHVLTKPVLEKSL+SMLV+ADERRK G A Sbjct: 973 QQEYLESGADHVLTKPVLEKSLRSMLVIADERRKSGHA 1010 >gb|EMD39331.1| histidine kinase [Ceriporiopsis subvermispora B] Length = 1173 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/46 (71%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKR--GSAQVISEQ 340 Q+EYLEAG DHVLTKPVLEKSLK ML++ADERRKR G+ Q+ +Q Sbjct: 1087 QQEYLEAGADHVLTKPVLEKSLKRMLLIADERRKRPIGTTQMSEQQ 1132 >ref|XP_007400950.1| hypothetical protein PHACADRAFT_152889 [Phanerochaete carnosa HHB-10118-sp] gi|409041199|gb|EKM50685.1| hypothetical protein PHACADRAFT_152889 [Phanerochaete carnosa HHB-10118-sp] Length = 1096 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRGS 361 Q+EYLEAGVDHVLTKPV EKSL++MLV+A+ERRKRG+ Sbjct: 1047 QQEYLEAGVDHVLTKPVFEKSLRAMLVIAEERRKRGT 1083 >ref|XP_002470995.1| hypothetical hybrid sensor histidine kinase [Postia placenta Mad-698-R] gi|220729897|gb|EED83763.1| hypothetical hybrid sensor histidine kinase [Postia placenta Mad-698-R] Length = 1093 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRK 370 Q+EYLEAG DHVLTKPVLEKSLKSMLV+ADERRK Sbjct: 1031 QREYLEAGADHVLTKPVLEKSLKSMLVIADERRK 1064 >ref|XP_002471647.1| hypothetical histidine kinase [Postia placenta Mad-698-R] gi|220729323|gb|EED83200.1| hypothetical histidine kinase [Postia placenta Mad-698-R] Length = 878 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRK 370 Q+EYLEAG DHVLTKPVLEKSLKSMLV+ADERRK Sbjct: 818 QREYLEAGADHVLTKPVLEKSLKSMLVIADERRK 851 >ref|XP_007371002.1| hypothetical protein DICSQDRAFT_71854 [Dichomitus squalens LYAD-421 SS1] gi|395323809|gb|EJF56265.1| hypothetical protein DICSQDRAFT_71854 [Dichomitus squalens LYAD-421 SS1] Length = 1079 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRGSAQVISEQR 337 Q+EY+ AGVDHVLTKPVLEKSLKSML +A+ERR+RG Q Q+ Sbjct: 1030 QQEYVNAGVDHVLTKPVLEKSLKSMLSIAEERRRRGLQQTHESQQ 1074 >gb|EPQ54871.1| hypothetical protein GLOTRDRAFT_111444 [Gloeophyllum trabeum ATCC 11539] Length = 1031 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKR 367 Q+EYLEAGVDHVLTKPV E SLK+MLV+ADERRKR Sbjct: 985 QQEYLEAGVDHVLTKPVREASLKTMLVLADERRKR 1019 >gb|EPQ56119.1| hypothetical protein GLOTRDRAFT_74634 [Gloeophyllum trabeum ATCC 11539] Length = 985 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKR 367 Q+EYL+AGVDHVLTKPVLEKSL++ML +ADERRKR Sbjct: 940 QEEYLQAGVDHVLTKPVLEKSLRNMLHLADERRKR 974 >gb|EUC59609.1| histidine kinase, putative [Rhizoctonia solani AG-3 Rhs1AP] Length = 1162 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRK 370 Q+EY EAGVDHVLTKPVLE+SLK MLV+ADERR+ Sbjct: 1118 QEEYYEAGVDHVLTKPVLERSLKQMLVMADERRR 1151 >emb|CCO28382.1| hypothetical protein BN14_02377 [Rhizoctonia solani AG-1 IB] Length = 78 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRK 370 Q+EY EAGVDHVLTKPVLE+SLK MLV+ADERR+ Sbjct: 34 QEEYYEAGVDHVLTKPVLERSLKQMLVMADERRR 67 >gb|ELU43511.1| putative histidine kinase [Rhizoctonia solani AG-1 IA] Length = 1092 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRK 370 Q+EY EAGVDHVLTKPVLE+SLK MLV+ADERR+ Sbjct: 1048 QEEYYEAGVDHVLTKPVLERSLKQMLVMADERRR 1081 >ref|XP_007400951.1| hypothetical protein PHACADRAFT_104556 [Phanerochaete carnosa HHB-10118-sp] gi|409041200|gb|EKM50686.1| hypothetical protein PHACADRAFT_104556 [Phanerochaete carnosa HHB-10118-sp] Length = 1069 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRGSAQVISEQ 340 Q+EYLEAGVD VLTKPV EKSLK++L ADERR+RG ISEQ Sbjct: 1020 QQEYLEAGVDRVLTKPVYEKSLKNVLAFADERRRRGYTP-ISEQ 1062 >ref|XP_007310505.1| hypothetical protein STEHIDRAFT_172642 [Stereum hirsutum FP-91666 SS1] gi|389739176|gb|EIM80370.1| hypothetical protein STEHIDRAFT_172642 [Stereum hirsutum FP-91666 SS1] Length = 1236 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/43 (65%), Positives = 37/43 (86%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKRGSAQVISE 343 Q+EYLEAGVD+VLTKPVLE+SL++MLV+AD+R K +A S+ Sbjct: 1189 QEEYLEAGVDYVLTKPVLERSLRNMLVMADDRNKHDAAATASD 1231 >gb|EUC53942.1| histidine kinase, putative [Rhizoctonia solani AG-3 Rhs1AP] Length = 1319 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRK 370 Q+EYL+AG ++VLTKPVLEKSLK+MLV+ADERRK Sbjct: 1278 QQEYLQAGANYVLTKPVLEKSLKAMLVLADERRK 1311 >gb|ETW78710.1| sensor histidine kinase-like protein [Heterobasidion irregulare TC 32-1] Length = 840 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADER 376 Q+EYLEAGVDHVLTKPVLEKSL+ ML VA ER Sbjct: 796 QEEYLEAGVDHVLTKPVLEKSLRHMLNVASER 827 >ref|XP_007382577.1| hypothetical protein PUNSTDRAFT_125617 [Punctularia strigosozonata HHB-11173 SS5] gi|390601671|gb|EIN11065.1| hypothetical protein PUNSTDRAFT_125617 [Punctularia strigosozonata HHB-11173 SS5] Length = 1101 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -3 Query: 471 QKEYLEAGVDHVLTKPVLEKSLKSMLVVADERRKR 367 Q EYL+AGVD VLTKPVLEKSLKSMLV+A +R++ Sbjct: 1066 QDEYLDAGVDQVLTKPVLEKSLKSMLVMASRKRRK 1100