BLASTX nr result
ID: Paeonia25_contig00016501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016501 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535144.1| dicer-1, putative [Ricinus communis] gi|2235... 60 4e-07 >ref|XP_002535144.1| dicer-1, putative [Ricinus communis] gi|223523936|gb|EEF27239.1| dicer-1, putative [Ricinus communis] Length = 259 Score = 59.7 bits (143), Expect = 4e-07 Identities = 34/58 (58%), Positives = 40/58 (68%) Frame = +1 Query: 22 VDVFVMDKLVGRATYHLNNKKDIAQNRAAKDALDKIECILGQINGTDNTENHLSVDIN 195 VDVF+ D+LVGR TY L KK+IA NRAAKDALD I ILG + TD+ L DI+ Sbjct: 199 VDVFIDDQLVGRGTYGL--KKEIAHNRAAKDALDNIGRILGDKDTTDHASCFLQTDID 254