BLASTX nr result
ID: Paeonia25_contig00016493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016493 (240 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW53090.1| MFS general substrate transporter [Trametes versi... 71 1e-10 ref|XP_007370880.1| MFS general substrate transporter [Dichomitu... 70 3e-10 gb|EIW53089.1| MFS general substrate transporter [Trametes versi... 70 3e-10 gb|EMD31558.1| hypothetical protein CERSUDRAFT_100231 [Ceriporio... 69 9e-10 gb|EPS97896.1| hypothetical protein FOMPIDRAFT_89630 [Fomitopsis... 63 5e-08 ref|XP_007370881.1| MFS general substrate transporter [Dichomitu... 62 1e-07 >gb|EIW53090.1| MFS general substrate transporter [Trametes versicolor FP-101664 SS1] Length = 525 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 240 RDREHGKIESYEQQLKGEEAGMHDLTEFENPYHRYVL 130 RDRE G + SYE Q+KGEEAGMHDLTEFENPYHRYVL Sbjct: 489 RDREQGLVTSYEDQIKGEEAGMHDLTEFENPYHRYVL 525 >ref|XP_007370880.1| MFS general substrate transporter [Dichomitus squalens LYAD-421 SS1] gi|395323921|gb|EJF56373.1| MFS general substrate transporter [Dichomitus squalens LYAD-421 SS1] Length = 499 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = -1 Query: 240 RDREHGKIESYEQQLKGEEAGMHDLTEFENPYHRYVL 130 RDRE GKI SYE QLKGEEAGMHDLTEFEN YHRY L Sbjct: 463 RDREQGKIVSYEDQLKGEEAGMHDLTEFENKYHRYAL 499 >gb|EIW53089.1| MFS general substrate transporter [Trametes versicolor FP-101664 SS1] Length = 556 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 240 RDREHGKIESYEQQLKGEEAGMHDLTEFENPYHRYVL 130 RDRE GK+ SYE QLKGEEAGMHDLTEFEN YHRYVL Sbjct: 520 RDRELGKVTSYEDQLKGEEAGMHDLTEFENRYHRYVL 556 >gb|EMD31558.1| hypothetical protein CERSUDRAFT_100231 [Ceriporiopsis subvermispora B] Length = 527 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 240 RDREHGKIESYEQQLKGEEAGMHDLTEFENPYHRYVL 130 +DR++GK+++YEQQLKGEEAGMHDLTE EN YHRYVL Sbjct: 491 KDRKYGKVDTYEQQLKGEEAGMHDLTEMENIYHRYVL 527 >gb|EPS97896.1| hypothetical protein FOMPIDRAFT_89630 [Fomitopsis pinicola FP-58527 SS1] Length = 523 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -1 Query: 240 RDREHGKIESYEQQLKGEEAGMHDLTEFENPYHRYVL 130 +DR++GK+ + E +LKGEEAGMHDLTEFEN YHRYVL Sbjct: 487 KDRKYGKVITEEDKLKGEEAGMHDLTEFENTYHRYVL 523 >ref|XP_007370881.1| MFS general substrate transporter [Dichomitus squalens LYAD-421 SS1] gi|395323922|gb|EJF56374.1| MFS general substrate transporter [Dichomitus squalens LYAD-421 SS1] Length = 523 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 240 RDREHGKIESYEQQLKGEEAGMHDLTEFENPYHRYVL 130 RDRE GK+ S QLKGEEAGMHDLTE+EN +HRYVL Sbjct: 487 RDREQGKVTSPGDQLKGEEAGMHDLTEWENKFHRYVL 523