BLASTX nr result
ID: Paeonia25_contig00016274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016274 (479 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUC56046.1| ATP-dependent DNA helicase PIF1, putative [Rhizoc... 62 1e-07 emb|CCO35593.1| DNA repair and recombination protein pif1,mitoch... 61 1e-07 >gb|EUC56046.1| ATP-dependent DNA helicase PIF1, putative [Rhizoctonia solani AG-3 Rhs1AP] Length = 1823 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/66 (43%), Positives = 45/66 (68%) Frame = -3 Query: 462 ISTKVIDVAAPRTGGRLTVFNVYVALSRSRGGDGIRLLCSYDRTALTKPMPESLQKREDE 283 + + ++D+A P +G LT+FN+YVALSRS G + IRLL +D + +P+ E L+ RED Sbjct: 1740 LQSVIVDIAKPPSGSGLTLFNIYVALSRSSGRNTIRLLRDFDEDVMLQPLDEDLE-REDS 1798 Query: 282 EIERRD 265 +E+ D Sbjct: 1799 RLEKLD 1804 >emb|CCO35593.1| DNA repair and recombination protein pif1,mitochondrial [Rhizoctonia solani AG-1 IB] Length = 1377 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/70 (44%), Positives = 42/70 (60%) Frame = -3 Query: 462 ISTKVIDVAAPRTGGRLTVFNVYVALSRSRGGDGIRLLCSYDRTALTKPMPESLQKREDE 283 I ++D+A P TG LT+ N+YVALSRS G D IR+L +D + KP+ L K EDE Sbjct: 1299 IPAAIVDIATPPTGSGLTLANIYVALSRSSGSDSIRILREFDESIFMKPVDYDLVK-EDE 1357 Query: 282 EIERRDSMVL 253 +E D + Sbjct: 1358 RLELLDQQTM 1367