BLASTX nr result
ID: Paeonia25_contig00016130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00016130 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007140263.1| hypothetical protein PHAVU_008G097400g [Phas... 59 7e-07 >ref|XP_007140263.1| hypothetical protein PHAVU_008G097400g [Phaseolus vulgaris] gi|561013396|gb|ESW12257.1| hypothetical protein PHAVU_008G097400g [Phaseolus vulgaris] Length = 61 Score = 58.5 bits (140), Expect(2) = 7e-07 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +1 Query: 64 VIHPPKREGSHRCSVKPAWRCALHFRDQETQVFTRTPWPKLPTWIGK 204 VI P EGS RCSV PA RCALHFR+QETQ F + PW +G+ Sbjct: 5 VIPPLSGEGSFRCSVNPASRCALHFRNQETQAFAQVPWFNSQLGVGR 51 Score = 20.4 bits (41), Expect(2) = 7e-07 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 182 NSQLGSGKPVNHPTGPAR 235 NSQLG G+P P + Sbjct: 44 NSQLGVGRPAFRNQSPTK 61