BLASTX nr result
ID: Paeonia25_contig00015525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00015525 (570 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530377.1| protein dimerization, putative [Ricinus comm... 55 1e-05 >ref|XP_002530377.1| protein dimerization, putative [Ricinus communis] gi|223530094|gb|EEF32010.1| protein dimerization, putative [Ricinus communis] Length = 698 Score = 55.5 bits (132), Expect = 1e-05 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 4/66 (6%) Frame = +1 Query: 259 PSLFYSSDFCFDDEVFSSLWSCVVGMVQDPN----IVAMVN*YRETKGAFKQGSKISISR 426 PSLFYS+DF D EV L C+V MVQDP I ++ YR +GAFK+GS I+ Sbjct: 511 PSLFYSTDFYSDPEVSFGLLCCIVRMVQDPRTQDLISLQLDEYRHARGAFKEGSAINKRT 570 Query: 427 DIATLQ 444 +I+ Q Sbjct: 571 NISPAQ 576