BLASTX nr result
ID: Paeonia25_contig00014908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00014908 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21469.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002513870.1| Aspartic proteinase nepenthesin-2 precursor,... 56 4e-06 >emb|CBI21469.3| unnamed protein product [Vitis vinifera] Length = 530 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +3 Query: 159 MARRSIIYLLCVCFFLENCMAVTFSSRLIHRFSDELKALRVSRNG--EVWPESRS 317 MA R ++ + V +E+CMA FS+RLIHRFSDE+KA R +R+G WPE R+ Sbjct: 1 MAARFLVAMSVVVLLIESCMAAMFSARLIHRFSDEVKAFRAARSGLSGSWPEWRT 55 >ref|XP_002513870.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] gi|223546956|gb|EEF48453.1| Aspartic proteinase nepenthesin-2 precursor, putative [Ricinus communis] Length = 535 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 4/57 (7%) Frame = +3 Query: 159 MARRSIIYLLCVCFFLENCMAVTFSSRLIHRFSDELKALRVSRNGEV----WPESRS 317 MA R +++++C CF + + +TFSS+LIHRFS+E K+L +S N V WP S Sbjct: 1 MAHRELLFVICFCFLSNHSIGLTFSSKLIHRFSEEAKSLLISGNDNVSSQTWPNKNS 57