BLASTX nr result
ID: Paeonia25_contig00013476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00013476 (206 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348470.1| PREDICTED: uncharacterized protein LOC102578... 83 5e-14 ref|XP_006348469.1| PREDICTED: uncharacterized protein LOC102578... 83 5e-14 ref|XP_004228676.1| PREDICTED: uncharacterized protein LOC101262... 83 5e-14 ref|XP_006399108.1| hypothetical protein EUTSA_v10014443mg [Eutr... 81 2e-13 ref|NP_568167.1| lecithin retinol acyltransferase domain protein... 81 2e-13 gb|EYU18120.1| hypothetical protein MIMGU_mgv1a012215mg [Mimulus... 80 2e-13 ref|XP_006288489.1| hypothetical protein CARUB_v10001754mg [Caps... 80 2e-13 ref|XP_007202460.1| hypothetical protein PRUPE_ppa010106mg [Prun... 79 7e-13 ref|NP_001241346.1| uncharacterized protein LOC100791242 [Glycin... 79 7e-13 ref|XP_002309251.2| hypothetical protein POPTR_0006s21980g [Popu... 78 1e-12 ref|XP_002873253.1| NC domain-containing protein [Arabidopsis ly... 78 1e-12 ref|XP_002266364.1| PREDICTED: uncharacterized protein LOC100260... 78 1e-12 ref|XP_004497660.1| PREDICTED: uncharacterized protein LOC101505... 77 2e-12 ref|XP_004303420.1| PREDICTED: uncharacterized protein LOC101308... 77 2e-12 ref|XP_004136514.1| PREDICTED: uncharacterized protein LOC101207... 77 2e-12 ref|XP_002533900.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_007145790.1| hypothetical protein PHAVU_007G268000g [Phas... 77 3e-12 ref|XP_003519117.1| PREDICTED: uncharacterized protein LOC100811... 77 3e-12 gb|ACU23792.1| unknown [Glycine max] 77 3e-12 ref|XP_007027973.1| NC domain-containing protein-related isoform... 76 6e-12 >ref|XP_006348470.1| PREDICTED: uncharacterized protein LOC102578879 isoform X2 [Solanum tuberosum] Length = 247 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+SLKPGDHIYSWRTAYIYAHHGIYVGDN Sbjct: 1 MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGIYVGDN 38 >ref|XP_006348469.1| PREDICTED: uncharacterized protein LOC102578879 isoform X1 [Solanum tuberosum] Length = 258 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+SLKPGDHIYSWRTAYIYAHHGIYVGDN Sbjct: 1 MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGIYVGDN 38 >ref|XP_004228676.1| PREDICTED: uncharacterized protein LOC101262646 [Solanum lycopersicum] Length = 258 Score = 82.8 bits (203), Expect = 5e-14 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+SLKPGDHIYSWRTAYIYAHHGIYVGDN Sbjct: 1 MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGIYVGDN 38 >ref|XP_006399108.1| hypothetical protein EUTSA_v10014443mg [Eutrema salsugineum] gi|557100198|gb|ESQ40561.1| hypothetical protein EUTSA_v10014443mg [Eutrema salsugineum] Length = 259 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+SLKPGDHIYSWRTAYIYAHHGIYVGD+ Sbjct: 1 MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGIYVGDD 38 >ref|NP_568167.1| lecithin retinol acyltransferase domain protein [Arabidopsis thaliana] gi|14190475|gb|AAK55718.1|AF380637_1 AT5g06370/MHF15_11 [Arabidopsis thaliana] gi|15809734|gb|AAL06795.1| AT5g06370/MHF15_11 [Arabidopsis thaliana] gi|110741026|dbj|BAE98607.1| hypothetical protein [Arabidopsis thaliana] gi|332003624|gb|AED91007.1| lecithin retinol acyltransferase domain protein [Arabidopsis thaliana] Length = 259 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+SLKPGDHIYSWRTAYIYAHHGIYVGD+ Sbjct: 1 MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGIYVGDD 38 >gb|EYU18120.1| hypothetical protein MIMGU_mgv1a012215mg [Mimulus guttatus] Length = 258 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R SLKPGDH+YSWRTAYIY+HHGIY+GDN Sbjct: 1 MGLLSNRIDRGSLKPGDHVYSWRTAYIYSHHGIYIGDN 38 >ref|XP_006288489.1| hypothetical protein CARUB_v10001754mg [Capsella rubella] gi|482557195|gb|EOA21387.1| hypothetical protein CARUB_v10001754mg [Capsella rubella] Length = 259 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+SLKPGDHIYSWRTAYIYAHHG+YVGD+ Sbjct: 1 MGLLSNRIDRSSLKPGDHIYSWRTAYIYAHHGVYVGDD 38 >ref|XP_007202460.1| hypothetical protein PRUPE_ppa010106mg [Prunus persica] gi|462397991|gb|EMJ03659.1| hypothetical protein PRUPE_ppa010106mg [Prunus persica] Length = 264 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+++ SLKPGDHIYSWRTAYIYAHHGIYVGD+ Sbjct: 1 MGLLSNRVDKGSLKPGDHIYSWRTAYIYAHHGIYVGDD 38 >ref|NP_001241346.1| uncharacterized protein LOC100791242 [Glycine max] gi|255641622|gb|ACU21083.1| unknown [Glycine max] Length = 259 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ R SLKPGDHIYSWRTAYIYAHHGIYVGD+ Sbjct: 1 MGLLSNRVTRESLKPGDHIYSWRTAYIYAHHGIYVGDD 38 >ref|XP_002309251.2| hypothetical protein POPTR_0006s21980g [Populus trichocarpa] gi|550336830|gb|EEE92774.2| hypothetical protein POPTR_0006s21980g [Populus trichocarpa] Length = 306 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI + SLKPGDHIYSWRTAYIYAHHGIY+GD+ Sbjct: 47 MGLLSNRISKESLKPGDHIYSWRTAYIYAHHGIYIGDD 84 >ref|XP_002873253.1| NC domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319090|gb|EFH49512.1| NC domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 259 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI+R+ LKPGDHIYSWRTAYIYAHHGI+VGD+ Sbjct: 1 MGLLSNRIDRSGLKPGDHIYSWRTAYIYAHHGIFVGDD 38 >ref|XP_002266364.1| PREDICTED: uncharacterized protein LOC100260806 [Vitis vinifera] gi|296083153|emb|CBI22789.3| unnamed protein product [Vitis vinifera] Length = 262 Score = 77.8 bits (190), Expect = 1e-12 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+++ SLKPGDHIYSWRTAYIY+HHGIYVG+N Sbjct: 1 MGLLSNRVDKESLKPGDHIYSWRTAYIYSHHGIYVGNN 38 >ref|XP_004497660.1| PREDICTED: uncharacterized protein LOC101505670 isoform X1 [Cicer arietinum] gi|502122267|ref|XP_004497661.1| PREDICTED: uncharacterized protein LOC101505670 isoform X2 [Cicer arietinum] Length = 264 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ R SLK GDH+YSWRTAYIYAHHGIY+GDN Sbjct: 1 MGLLSNRVSRESLKAGDHVYSWRTAYIYAHHGIYIGDN 38 >ref|XP_004303420.1| PREDICTED: uncharacterized protein LOC101308594 [Fragaria vesca subsp. vesca] Length = 299 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ + SLKPGDHIYSWRTAYIYAHHGIY+GD+ Sbjct: 1 MGLLSNRVAKGSLKPGDHIYSWRTAYIYAHHGIYIGDD 38 >ref|XP_004136514.1| PREDICTED: uncharacterized protein LOC101207710 [Cucumis sativus] gi|449515402|ref|XP_004164738.1| PREDICTED: uncharacterized LOC101207710 [Cucumis sativus] Length = 264 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGD 201 MGLLSNR+ R SLKPGDHIYSWR AYIYAHHGIYVGD Sbjct: 1 MGLLSNRVNRESLKPGDHIYSWRAAYIYAHHGIYVGD 37 >ref|XP_002533900.1| conserved hypothetical protein [Ricinus communis] gi|223526142|gb|EEF28482.1| conserved hypothetical protein [Ricinus communis] Length = 256 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNRI R SLKPGDHIYSWR AY+YAHHGIY+GD+ Sbjct: 1 MGLLSNRISRESLKPGDHIYSWRAAYVYAHHGIYIGDD 38 >ref|XP_007145790.1| hypothetical protein PHAVU_007G268000g [Phaseolus vulgaris] gi|561018980|gb|ESW17784.1| hypothetical protein PHAVU_007G268000g [Phaseolus vulgaris] Length = 263 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ R SL PGDHIYSWRTAYIYAHHGIYVGD+ Sbjct: 1 MGLLSNRVTRESLTPGDHIYSWRTAYIYAHHGIYVGDD 38 >ref|XP_003519117.1| PREDICTED: uncharacterized protein LOC100811771 isoform X1 [Glycine max] Length = 259 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ R SLKPGDHIYSWRTAYIYAHHGIYV D+ Sbjct: 1 MGLLSNRVTRESLKPGDHIYSWRTAYIYAHHGIYVSDD 38 >gb|ACU23792.1| unknown [Glycine max] Length = 259 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ R SLKPGDHIYSWRTAYIYAHHGIYV D+ Sbjct: 1 MGLLSNRVTRESLKPGDHIYSWRTAYIYAHHGIYVSDD 38 >ref|XP_007027973.1| NC domain-containing protein-related isoform 1 [Theobroma cacao] gi|508716578|gb|EOY08475.1| NC domain-containing protein-related isoform 1 [Theobroma cacao] Length = 338 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = +1 Query: 91 MGLLSNRIERNSLKPGDHIYSWRTAYIYAHHGIYVGDN 204 MGLLSNR+ + SLKPGDHIYSWRTAYIYAHHGIYVG++ Sbjct: 73 MGLLSNRVAKESLKPGDHIYSWRTAYIYAHHGIYVGND 110