BLASTX nr result
ID: Paeonia25_contig00013437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00013437 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001233823.1| small GTP-binding protein [Solanum lycopersi... 57 3e-06 ref|XP_006440203.1| hypothetical protein CICLE_v10023527mg [Citr... 57 4e-06 emb|CAA98161.1| RAB1D [Lotus japonicus] 56 5e-06 ref|XP_004239838.1| PREDICTED: ras-related protein RABD2a-like [... 55 8e-06 emb|CAA51011.1| ras-related GTP-binding protein [Nicotiana tabacum] 55 8e-06 >ref|NP_001233823.1| small GTP-binding protein [Solanum lycopersicum] gi|1053063|gb|AAA80678.1| small GTP-binding protein [Solanum lycopersicum] Length = 203 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/46 (69%), Positives = 34/46 (73%), Gaps = 8/46 (17%) Frame = +1 Query: 67 DSGVGKSRLLQRFGDDLYLESYIST--------TVEQDWETIKLQI 180 DSGVGKSRLL RF DD YLESYIST TV+QD +TIKLQI Sbjct: 16 DSGVGKSRLLLRFADDSYLESYISTIGVDFKIRTVDQDGKTIKLQI 61 >ref|XP_006440203.1| hypothetical protein CICLE_v10023527mg [Citrus clementina] gi|557542465|gb|ESR53443.1| hypothetical protein CICLE_v10023527mg [Citrus clementina] Length = 108 Score = 56.6 bits (135), Expect = 4e-06 Identities = 34/50 (68%), Positives = 35/50 (70%), Gaps = 8/50 (16%) Frame = +1 Query: 67 DSGVGKSRLLQRFGDDLYLESYIST--------TVEQDWETIKLQIDALL 192 DSGVGKS LL RF DD YLESYIST TVEQD +TIKLQI LL Sbjct: 16 DSGVGKSCLLLRFADDSYLESYISTIGVDFKIRTVEQDGKTIKLQICELL 65 >emb|CAA98161.1| RAB1D [Lotus japonicus] Length = 203 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/46 (69%), Positives = 34/46 (73%), Gaps = 8/46 (17%) Frame = +1 Query: 67 DSGVGKSRLLQRFGDDLYLESYIST--------TVEQDWETIKLQI 180 DSGVGKS LL RFGDD Y+ESYIST TVEQD +TIKLQI Sbjct: 16 DSGVGKSCLLLRFGDDSYIESYISTIGVDFKIRTVEQDAKTIKLQI 61 >ref|XP_004239838.1| PREDICTED: ras-related protein RABD2a-like [Solanum lycopersicum] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/46 (69%), Positives = 33/46 (71%), Gaps = 8/46 (17%) Frame = +1 Query: 67 DSGVGKSRLLQRFGDDLYLESYIST--------TVEQDWETIKLQI 180 DSGVGKS LL RF DD YLESYIST TVEQD +TIKLQI Sbjct: 16 DSGVGKSCLLLRFADDTYLESYISTIGVDFKIRTVEQDGKTIKLQI 61 >emb|CAA51011.1| ras-related GTP-binding protein [Nicotiana tabacum] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/46 (69%), Positives = 33/46 (71%), Gaps = 8/46 (17%) Frame = +1 Query: 67 DSGVGKSRLLQRFGDDLYLESYIST--------TVEQDWETIKLQI 180 DSGVGKS LL RF DD YLESYIST TVEQD +TIKLQI Sbjct: 16 DSGVGKSCLLLRFADDTYLESYISTIGVDFKIRTVEQDGKTIKLQI 61