BLASTX nr result
ID: Paeonia25_contig00013170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00013170 (517 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006602844.1| PREDICTED: putative pentatricopeptide repeat... 42 4e-06 >ref|XP_006602844.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Glycine max] Length = 756 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +3 Query: 444 FRQINNYNVVLWTSMLSSYALHGQ 515 FRQ N N+V+WTSM+S YALHGQ Sbjct: 442 FRQSNEPNIVMWTSMISGYALHGQ 465 Score = 34.3 bits (77), Expect(2) = 4e-06 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +1 Query: 361 GGWLDIMLENSISDFYVKSGNLDDAWVVLDKS 456 G +D + +S+ D Y KSG+LDDAW+V +S Sbjct: 414 GHRIDAYVGSSLIDMYSKSGSLDDAWMVFRQS 445