BLASTX nr result
ID: Paeonia25_contig00012420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00012420 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD33613.1| hypothetical protein CERSUDRAFT_141850 [Ceriporio... 61 2e-07 ref|XP_007369605.1| acetolactate synthase [Dichomitus squalens L... 59 5e-07 gb|EIW63208.1| acetolactate synthase [Trametes versicolor FP-101... 59 5e-07 gb|ESK92954.1| mitochondrial acetolactate synthase small subunit... 58 1e-06 emb|CCL99843.1| predicted protein [Fibroporia radiculosa] 57 3e-06 ref|XP_007339273.1| acetolactate synthase [Auricularia delicata ... 57 3e-06 ref|XP_001830478.2| acetolactate synthase [Coprinopsis cinerea o... 57 3e-06 ref|XP_007397127.1| hypothetical protein PHACADRAFT_258278 [Phan... 56 5e-06 ref|XP_003029903.1| hypothetical protein SCHCODRAFT_85799 [Schiz... 56 5e-06 ref|XP_007317491.1| hypothetical protein SERLADRAFT_355665 [Serp... 56 6e-06 gb|EPS96248.1| hypothetical protein FOMPIDRAFT_1130827 [Fomitops... 55 8e-06 >gb|EMD33613.1| hypothetical protein CERSUDRAFT_141850 [Ceriporiopsis subvermispora B] Length = 348 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS HSVIV++C KT RVEAFL+L++PFGLLE ART Sbjct: 278 VDVSEHSVIVEMCGKTSRVEAFLALLKPFGLLEAART 314 >ref|XP_007369605.1| acetolactate synthase [Dichomitus squalens LYAD-421 SS1] gi|395325207|gb|EJF57633.1| acetolactate synthase [Dichomitus squalens LYAD-421 SS1] Length = 362 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS HSVIV++C KT RVEAFLSL++PFG+LE ART Sbjct: 293 VDVSEHSVIVEMCGKTKRVEAFLSLLKPFGVLESART 329 >gb|EIW63208.1| acetolactate synthase [Trametes versicolor FP-101664 SS1] Length = 343 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS HSVIV++C KT RVEAFL+L++PFGLLE ART Sbjct: 274 VDVSEHSVIVEMCGKTKRVEAFLALLKPFGLLESART 310 >gb|ESK92954.1| mitochondrial acetolactate synthase small subunit [Moniliophthora roreri MCA 2997] Length = 339 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS +SVIV+L AKT RVEAFLSLV+PFG+LE ART Sbjct: 269 VDVSENSVIVELTAKTSRVEAFLSLVKPFGILEAART 305 >emb|CCL99843.1| predicted protein [Fibroporia radiculosa] Length = 354 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS +SVIV+LC KT RVEAFL+L++PFG+LE ART Sbjct: 284 VDVSENSVIVELCGKTKRVEAFLALLKPFGVLEAART 320 >ref|XP_007339273.1| acetolactate synthase [Auricularia delicata TFB-10046 SS5] gi|393245031|gb|EJD52542.1| acetolactate synthase [Auricularia delicata TFB-10046 SS5] Length = 309 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS HSVIV++ KT RVEAFL LVRPFG+LE ART Sbjct: 240 VDVSEHSVIVEMTGKTRRVEAFLKLVRPFGILESART 276 >ref|XP_001830478.2| acetolactate synthase [Coprinopsis cinerea okayama7#130] gi|298409531|gb|EAU91358.2| acetolactate synthase [Coprinopsis cinerea okayama7#130] Length = 330 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS HSVIV+ AKT RVEAFL+L++PFG+LE ART Sbjct: 260 VDVSEHSVIVEYTAKTSRVEAFLNLLKPFGILEAART 296 >ref|XP_007397127.1| hypothetical protein PHACADRAFT_258278 [Phanerochaete carnosa HHB-10118-sp] gi|409044954|gb|EKM54435.1| hypothetical protein PHACADRAFT_258278 [Phanerochaete carnosa HHB-10118-sp] Length = 333 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS HSVIV++ KT +VEAFLSL++PFGLLE ART Sbjct: 263 VDVSEHSVIVEISGKTSKVEAFLSLLKPFGLLESART 299 >ref|XP_003029903.1| hypothetical protein SCHCODRAFT_85799 [Schizophyllum commune H4-8] gi|300103593|gb|EFI95000.1| hypothetical protein SCHCODRAFT_85799 [Schizophyllum commune H4-8] Length = 335 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS +SVIV+L AKT RVEAFLSLV+P+G+LE ART Sbjct: 264 VDVSENSVIVELTAKTTRVEAFLSLVKPYGILEAART 300 >ref|XP_007317491.1| hypothetical protein SERLADRAFT_355665 [Serpula lacrymans var. lacrymans S7.9] gi|336371459|gb|EGN99798.1| hypothetical protein SERLA73DRAFT_88488 [Serpula lacrymans var. lacrymans S7.3] gi|336384221|gb|EGO25369.1| hypothetical protein SERLADRAFT_355665 [Serpula lacrymans var. lacrymans S7.9] Length = 344 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS +S+IV+L AKT RVEAFLSL++PFG+LE ART Sbjct: 273 VDVSENSIIVELTAKTNRVEAFLSLLKPFGILESART 309 >gb|EPS96248.1| hypothetical protein FOMPIDRAFT_1130827 [Fomitopsis pinicola FP-58527 SS1] Length = 347 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 127 VDVSAHSVIVQLCAKTGRVEAFLSLVRPFGLLEVART 237 VDVS +SVIV+L KT RVEAFL+LV+PFGLLE ART Sbjct: 277 VDVSENSVIVELSGKTKRVEAFLALVKPFGLLEAART 313