BLASTX nr result
ID: Paeonia25_contig00011468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00011468 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004488998.1| PREDICTED: probable leucine-rich repeat rece... 59 7e-07 ref|XP_003596231.1| Leucine-rich repeat family protein / protein... 59 7e-07 ref|XP_003596234.1| Leucine-rich repeat family protein /protein ... 59 9e-07 ref|XP_006593302.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 ref|XP_006477833.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 ref|XP_007149530.1| hypothetical protein PHAVU_005G077900g [Phas... 57 3e-06 ref|XP_007149527.1| hypothetical protein PHAVU_005G077600g, part... 57 3e-06 ref|XP_007149524.1| hypothetical protein PHAVU_005G077400g, part... 57 3e-06 ref|XP_004489067.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 ref|XP_004488997.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 ref|XP_004488996.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 ref|XP_004488995.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 ref|XP_006442357.1| hypothetical protein CICLE_v10018686mg [Citr... 56 5e-06 ref|XP_006442308.1| hypothetical protein CICLE_v10024314mg, part... 56 5e-06 >ref|XP_004488998.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cicer arietinum] Length = 1007 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 VNLHFAEI+FTDDQTYASLGRR+FD+Y+Q Sbjct: 496 VNLHFAEIMFTDDQTYASLGRRVFDIYLQ 524 >ref|XP_003596231.1| Leucine-rich repeat family protein / protein kinase family protein [Medicago truncatula] gi|355485279|gb|AES66482.1| Leucine-rich repeat family protein / protein kinase family protein [Medicago truncatula] Length = 974 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 VNLHFAEI+FTDDQTYASLGRR+FD+Y+Q Sbjct: 474 VNLHFAEIMFTDDQTYASLGRRVFDIYLQ 502 >ref|XP_003596234.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] gi|355485282|gb|AES66485.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] Length = 255 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 VNLHFAEI+FTDDQTY+SLGRR+FD+Y+Q Sbjct: 98 VNLHFAEIMFTDDQTYSSLGRRVFDIYIQ 126 >ref|XP_006593302.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Glycine max] Length = 858 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 V+LHFAEI+FTDDQTY+SLGRR+FD+Y+Q Sbjct: 348 VSLHFAEIMFTDDQTYSSLGRRVFDIYIQ 376 >ref|XP_006477833.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Citrus sinensis] Length = 996 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQWLLQI 233 VNLHFAE +FTDD+TY SLGRRIFDVY+Q L++ Sbjct: 491 VNLHFAETMFTDDKTYKSLGRRIFDVYIQGKLEL 524 >ref|XP_007149530.1| hypothetical protein PHAVU_005G077900g [Phaseolus vulgaris] gi|561022794|gb|ESW21524.1| hypothetical protein PHAVU_005G077900g [Phaseolus vulgaris] Length = 678 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 ++LHFAEI+FTDDQTY+SLGRR+FD+YVQ Sbjct: 169 ISLHFAEIMFTDDQTYSSLGRRVFDIYVQ 197 >ref|XP_007149527.1| hypothetical protein PHAVU_005G077600g, partial [Phaseolus vulgaris] gi|561022791|gb|ESW21521.1| hypothetical protein PHAVU_005G077600g, partial [Phaseolus vulgaris] Length = 670 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 ++LHFAEI+FTDDQTY+SLGRR+FD+YVQ Sbjct: 165 ISLHFAEIMFTDDQTYSSLGRRVFDIYVQ 193 >ref|XP_007149524.1| hypothetical protein PHAVU_005G077400g, partial [Phaseolus vulgaris] gi|561022788|gb|ESW21518.1| hypothetical protein PHAVU_005G077400g, partial [Phaseolus vulgaris] Length = 673 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 ++LHFAEI+FTDDQTY+SLGRR+FD+YVQ Sbjct: 165 ISLHFAEIMFTDDQTYSSLGRRVFDIYVQ 193 >ref|XP_004489067.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cicer arietinum] Length = 1010 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 VNLHFAEI+FTDDQTY +LGRRIFD+Y+Q Sbjct: 499 VNLHFAEIMFTDDQTYNNLGRRIFDIYIQ 527 >ref|XP_004488997.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like isoform X3 [Cicer arietinum] Length = 876 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 V LHFAEI+FTDDQTYASLGRR+FD+Y+Q Sbjct: 364 VTLHFAEIMFTDDQTYASLGRRVFDIYLQ 392 >ref|XP_004488996.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like isoform X2 [Cicer arietinum] Length = 876 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 V LHFAEI+FTDDQTYASLGRR+FD+Y+Q Sbjct: 364 VTLHFAEIMFTDDQTYASLGRRVFDIYLQ 392 >ref|XP_004488995.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like isoform X1 [Cicer arietinum] Length = 1008 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 V LHFAEI+FTDDQTYASLGRR+FD+Y+Q Sbjct: 496 VTLHFAEIMFTDDQTYASLGRRVFDIYLQ 524 >ref|XP_006442357.1| hypothetical protein CICLE_v10018686mg [Citrus clementina] gi|557544619|gb|ESR55597.1| hypothetical protein CICLE_v10018686mg [Citrus clementina] Length = 996 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQWLLQI 233 VNLHFAE +FTDD+TY SLGRRIFD+Y+Q L++ Sbjct: 491 VNLHFAETMFTDDKTYKSLGRRIFDIYIQGKLEL 524 >ref|XP_006442308.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina] gi|557544570|gb|ESR55548.1| hypothetical protein CICLE_v10024314mg, partial [Citrus clementina] Length = 925 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 334 VNLHFAEIIFTDDQTYASLGRRIFDVYVQ 248 VNLHFAEI+FTDD++Y SLGRRIFDVY+Q Sbjct: 407 VNLHFAEILFTDDKSYCSLGRRIFDVYIQ 435