BLASTX nr result
ID: Paeonia25_contig00011096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00011096 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038399.1| BCL-2-associated athanogene 7, putative [The... 59 7e-07 >ref|XP_007038399.1| BCL-2-associated athanogene 7, putative [Theobroma cacao] gi|508775644|gb|EOY22900.1| BCL-2-associated athanogene 7, putative [Theobroma cacao] Length = 396 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -3 Query: 147 MARFRRIEIIEPCSS-LLIRETSIFSPKIQRFPYFAEEEMELGFALDFLN 1 M+RFRRI+I+EP SS L +++TSIF+PK FP F EEE +L FALD LN Sbjct: 1 MSRFRRIDILEPYSSPLFVKKTSIFAPKPLAFPSFFEEEDDLTFALDVLN 50