BLASTX nr result
ID: Paeonia25_contig00010951
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00010951 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 110 2e-22 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 110 2e-22 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 109 3e-22 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 107 2e-21 gb|ACV50425.1| cold induced plasma membrane protein [Jatropha cu... 106 3e-21 ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like is... 106 4e-21 ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [G... 106 4e-21 gb|AHL20265.1| stress-induced protein [Olea europaea] 105 9e-21 ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobrom... 105 9e-21 gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes ... 105 9e-21 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 105 9e-21 dbj|BAG54793.1| plasma membrance protein3 [Puccinellia tenuiflor... 104 1e-20 ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prun... 104 1e-20 ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like is... 103 2e-20 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 103 2e-20 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 103 2e-20 ref|XP_003562607.1| PREDICTED: hydrophobic protein LTI6A-like [B... 103 2e-20 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] 102 4e-20 ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 102 4e-20 gb|EPS73096.1| stress-induced hydrophobic peptide [Genlisea aurea] 102 4e-20 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 110 bits (276), Expect = 2e-22 Identities = 49/57 (85%), Positives = 55/57 (96%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MAD+GTANC+DIL+A++LPPLGVFLKF C+ EFWICLLLTLFGYIPGIIYAVYAITK Sbjct: 1 MADKGTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 110 bits (275), Expect = 2e-22 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MADEGTA C+DI++A++LPPLGVFLKF CK EFWICLLLT+FGYIPGIIYAVYAITK Sbjct: 1 MADEGTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 57 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 109 bits (273), Expect = 3e-22 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MADEGTANC+DIL+A+LLPPLGVFLKF C EFWICL+LT FGYIPGIIYA+YAITK Sbjct: 1 MADEGTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFFGYIPGIIYAIYAITK 57 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 107 bits (267), Expect = 2e-21 Identities = 50/62 (80%), Positives = 55/62 (88%) Frame = +1 Query: 106 KTR*EMADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAI 285 K + +MAD TA CVDIL+AV+LPPLGVFLKF CKAEFWICLLLT+ GYIPGIIYAVYAI Sbjct: 42 KNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 101 Query: 286 TK 291 TK Sbjct: 102 TK 103 >gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas] Length = 57 Score = 106 bits (265), Expect = 3e-21 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 M EGTA C+DIL+AV+LPPLGVFLKF CKAEFWICLLLT+ GYIPGIIYAVYAITK Sbjct: 1 MPSEGTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Citrus sinensis] gi|568853390|ref|XP_006480342.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Citrus sinensis] Length = 58 Score = 106 bits (264), Expect = 4e-21 Identities = 49/57 (85%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MAD TA CVDIL+AV+LPPLGVFLKF CKAEFWICLLLT+ GYIPGIIYAVYAITK Sbjct: 1 MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 57 >ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max] Length = 57 Score = 106 bits (264), Expect = 4e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MAD+ TA C+DIL+A++LPPLGVFLK+ CK EFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 1 MADDSTATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|AHL20265.1| stress-induced protein [Olea europaea] Length = 58 Score = 105 bits (261), Expect = 9e-21 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MAD+GTA C+DI++A+LLPPLGVFL++ CK EFWICLLLT+ GY+PGIIYAVYAITK Sbjct: 1 MADDGTATCIDIIVAILLPPLGVFLRYGCKVEFWICLLLTILGYLPGIIYAVYAITK 57 >ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobroma cacao] gi|508719879|gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] Length = 58 Score = 105 bits (261), Expect = 9e-21 Identities = 46/57 (80%), Positives = 53/57 (92%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MAD+ TA CVDIL+A++LPPLGVFLK+ C+ EFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 1 MADDSTATCVDILLAIILPPLGVFLKYGCEVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes songorica] Length = 57 Score = 105 bits (261), Expect = 9e-21 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MADEGTA+C+DILIA++LPPLGVFLKF C EFWICLLLT GY+PGIIYAVYAITK Sbjct: 1 MADEGTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYLPGIIYAVYAITK 57 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 105 bits (261), Expect = 9e-21 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +1 Query: 130 EGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 +GTANC+DILIA++LPPLGVFLKF CK EFW+CLLLT FGY+PGIIYAVYAITK Sbjct: 3 DGTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFFGYLPGIIYAVYAITK 56 >dbj|BAG54793.1| plasma membrance protein3 [Puccinellia tenuiflora] gi|326525641|dbj|BAJ88867.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|473798548|gb|EMS46527.1| Hydrophobic protein LTI6A [Triticum urartu] gi|475526762|gb|EMT07358.1| Hydrophobic protein LTI6A [Aegilops tauschii] Length = 57 Score = 104 bits (260), Expect = 1e-20 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MADEGTANC+DI++A++LPPLGVF KFAC EFWICLLLT FGY+PGIIYAV+ ITK Sbjct: 1 MADEGTANCIDIILAIILPPLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 57 >ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] gi|462403051|gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica] Length = 57 Score = 104 bits (259), Expect = 1e-20 Identities = 48/57 (84%), Positives = 51/57 (89%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 M EGTAN +DILIA+LLPPLGVFLKF C EFWICLLLT+FGYIPGIIYAVYAITK Sbjct: 1 MPSEGTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAVYAITK 57 >ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria italica] Length = 56 Score = 103 bits (258), Expect = 2e-20 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +1 Query: 130 EGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 EGTANCVDILIA++LPPLGVFLKF CK EFWICLLLT GY+PGIIYA+YAITK Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 103 bits (258), Expect = 2e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 130 EGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 EGTANCVDILIA++LPPLGVFLKF CK EFW+CLLLT GY+PGIIYA+YAITK Sbjct: 3 EGTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 103 bits (257), Expect = 2e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 130 EGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 EGTANC+DILIA++LPPLGVFLKF CK EFWICLLLT GY+PGIIYA+YAITK Sbjct: 3 EGTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTFLGYLPGIIYAIYAITK 56 >ref|XP_003562607.1| PREDICTED: hydrophobic protein LTI6A-like [Brachypodium distachyon] Length = 57 Score = 103 bits (257), Expect = 2e-20 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MADEGTANC+DI++A++LPPLGVF KFAC EFWICLLLT FGY+PGIIYAV+ IT+ Sbjct: 1 MADEGTANCIDIILAIILPPLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITR 57 >gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 102 bits (255), Expect = 4e-20 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 M +G+A CVDIL+A++LPPLGVFLKF C+AEFWICLLLTLFGY+PGIIYAVY ITK Sbjct: 1 MRGQGSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 102 bits (255), Expect = 4e-20 Identities = 44/58 (75%), Positives = 53/58 (91%) Frame = +1 Query: 118 EMADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 +MA +G A C+DIL+A++LPPLGVFLK+ C+ EFWICL+LTLFGYIPGIIYAVYAITK Sbjct: 47 KMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLFGYIPGIIYAVYAITK 104 >gb|EPS73096.1| stress-induced hydrophobic peptide [Genlisea aurea] Length = 57 Score = 102 bits (255), Expect = 4e-20 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +1 Query: 121 MADEGTANCVDILIAVLLPPLGVFLKFACKAEFWICLLLTLFGYIPGIIYAVYAITK 291 MADEGTA C+DIL+A++LPPLGVFLK+ C EFWI L+LTLFGY+PGIIYAVYAITK Sbjct: 1 MADEGTATCIDILVAIILPPLGVFLKYGCGIEFWISLILTLFGYLPGIIYAVYAITK 57