BLASTX nr result
ID: Paeonia25_contig00008991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00008991 (850 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007385752.1| UPF0057-domain-containing protein [Punctular... 89 3e-15 gb|EPS29881.1| hypothetical protein PDE_04831 [Penicillium oxali... 86 2e-14 ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI... 86 2e-14 ref|XP_002562011.1| Pc18g01670 [Penicillium chrysogenum Wisconsi... 86 2e-14 ref|XP_001910957.1| hypothetical protein [Podospora anserina S m... 86 2e-14 ref|XP_003842318.1| hypothetical protein LEMA_P080780.1 [Leptosp... 80 2e-14 gb|EUC33038.1| hypothetical protein COCCADRAFT_5327 [Bipolaris z... 85 3e-14 ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] ... 85 3e-14 ref|XP_002152869.1| stress response RCI peptide, putative [Talar... 85 4e-14 sp|Q4HXT6.2|PMP3_GIBZE RecName: Full=Plasma membrane proteolipid... 84 5e-14 ref|XP_003661311.1| hypothetical protein MYCTH_2314489 [Myceliop... 84 7e-14 ref|XP_002486625.1| stress response RCI peptide, putative [Talar... 84 7e-14 gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces gra... 84 9e-14 ref|XP_007338654.1| UPF0057-domain-containing protein [Auricular... 84 9e-14 gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxyspor... 84 9e-14 gb|EFX02834.1| stress response RCI peptide [Grosmannia clavigera... 84 9e-14 gb|EFQ35058.1| hypothetical protein GLRG_10202 [Colletotrichum g... 84 9e-14 gb|ETW85769.1| putative stress-induced hydrophobic peptide [Hete... 83 1e-13 gb|ENI09224.1| hypothetical protein COCC4DRAFT_68773 [Bipolaris ... 83 1e-13 gb|EME87335.1| hypothetical protein MYCFIDRAFT_180921 [Pseudocer... 83 1e-13 >ref|XP_007385752.1| UPF0057-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] gi|390598060|gb|EIN07459.1| UPF0057-domain-containing protein [Punctularia strigosozonata HHB-11173 SS5] Length = 57 Score = 88.6 bits (218), Expect = 3e-15 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 M TGSDICKIIFAIILPP+GVFLERG+GADFLINILLTILGYIPG Sbjct: 1 MAFTGSDICKIIFAIILPPVGVFLERGLGADFLINILLTILGYIPG 46 >gb|EPS29881.1| hypothetical protein PDE_04831 [Penicillium oxalicum 114-2] Length = 57 Score = 85.9 bits (211), Expect = 2e-14 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP+T SD+CKIIFAIILPP+GVFLERG GAD LINILLTILGYIPG Sbjct: 1 MPLTASDVCKIIFAIILPPLGVFLERGCGADLLINILLTILGYIPG 46 >ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256731818|gb|EEU45167.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 57 Score = 85.9 bits (211), Expect = 2e-14 Identities = 41/46 (89%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKII AIILPP+GVFLERG GADFLINILLTILGYIPG Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFLINILLTILGYIPG 46 >ref|XP_002562011.1| Pc18g01670 [Penicillium chrysogenum Wisconsin 54-1255] gi|211586744|emb|CAP94391.1| Pc18g01670 [Penicillium chrysogenum Wisconsin 54-1255] gi|584409824|emb|CDM33848.1| Plasma membrane proteolipid 3 [Penicillium roqueforti] Length = 57 Score = 85.9 bits (211), Expect = 2e-14 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKIIFAIILPP+GVFLERG GADFLINILLTILG+IPG Sbjct: 1 MPFTASDICKIIFAIILPPLGVFLERGCGADFLINILLTILGWIPG 46 >ref|XP_001910957.1| hypothetical protein [Podospora anserina S mat+] gi|170945981|emb|CAP72782.1| unnamed protein product [Podospora anserina S mat+] Length = 57 Score = 85.9 bits (211), Expect = 2e-14 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP TGSDICKIIFA++LPP+GVFLERG GAD LIN+LLTILGYIPG Sbjct: 1 MPFTGSDICKIIFAVLLPPLGVFLERGCGADLLINLLLTILGYIPG 46 >ref|XP_003842318.1| hypothetical protein LEMA_P080780.1 [Leptosphaeria maculans JN3] gi|312218894|emb|CBX98839.1| hypothetical protein LEMA_P080780.1 [Leptosphaeria maculans JN3] Length = 131 Score = 79.7 bits (195), Expect(2) = 2e-14 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIP 588 MP T SDICKI+ AIILPP+GVFLERG ADFLINILLT+LGYIP Sbjct: 1 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLTVLGYIP 45 Score = 26.6 bits (57), Expect(2) = 2e-14 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = +3 Query: 588 RHHPRAIHHPQILSS 632 R+HPRA+H+ Q+L+S Sbjct: 47 RYHPRAVHYFQVLAS 61 >gb|EUC33038.1| hypothetical protein COCCADRAFT_5327 [Bipolaris zeicola 26-R-13] gi|576932050|gb|EUC45599.1| hypothetical protein COCMIDRAFT_5223 [Bipolaris oryzae ATCC 44560] gi|578484591|gb|EUN22110.1| hypothetical protein COCVIDRAFT_30797 [Bipolaris victoriae FI3] Length = 57 Score = 85.1 bits (209), Expect = 3e-14 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKI+ AIILPP+GVFLERG GADFLINILLTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFLINILLTILGYIPG 46 >ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] gi|340515326|gb|EGR45581.1| predicted protein [Trichoderma reesei QM6a] gi|572275412|gb|ETR98847.1| UPF0057-domain-containing protein [Trichoderma reesei RUT C-30] Length = 57 Score = 85.1 bits (209), Expect = 3e-14 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKI+ AIILPP+GVFLERG GADFLINILLTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFLINILLTILGYIPG 46 >ref|XP_002152869.1| stress response RCI peptide, putative [Talaromyces marneffei ATCC 18224] gi|210065838|gb|EEA19932.1| stress response RCI peptide, putative [Talaromyces marneffei ATCC 18224] Length = 57 Score = 84.7 bits (208), Expect = 4e-14 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP+T SDICKIIFAIILPP+GVFLERG GAD LINI LTILGYIPG Sbjct: 1 MPLTASDICKIIFAIILPPVGVFLERGCGADLLINICLTILGYIPG 46 >sp|Q4HXT6.2|PMP3_GIBZE RecName: Full=Plasma membrane proteolipid 3 gi|558866824|gb|ESU16907.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|596545806|gb|EYB25849.1| hypothetical protein FG05_10222 [Fusarium graminearum] Length = 57 Score = 84.3 bits (207), Expect = 5e-14 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKII AIILPP+GVFLERG GADF INILLTILGYIPG Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTILGYIPG 46 >ref|XP_003661311.1| hypothetical protein MYCTH_2314489 [Myceliophthora thermophila ATCC 42464] gi|347008579|gb|AEO56066.1| hypothetical protein MYCTH_2314489 [Myceliophthora thermophila ATCC 42464] Length = 57 Score = 84.0 bits (206), Expect = 7e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP+T SDICKIIFAIILPP+GVFLERG ADF INILLTILGY+PG Sbjct: 1 MPLTASDICKIIFAIILPPLGVFLERGCNADFFINILLTILGYLPG 46 >ref|XP_002486625.1| stress response RCI peptide, putative [Talaromyces stipitatus ATCC 10500] gi|218714964|gb|EED14387.1| stress response RCI peptide, putative [Talaromyces stipitatus ATCC 10500] Length = 57 Score = 84.0 bits (206), Expect = 7e-14 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKIIFAIILPP+GVFLERG GAD LINI LTILGYIPG Sbjct: 1 MPFTASDICKIIFAIILPPVGVFLERGCGADLLINICLTILGYIPG 46 >gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 83 Score = 83.6 bits (205), Expect = 9e-14 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +1 Query: 451 NMPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 NMP T SDICKII A+ILPP+GVFLERG GAD LINILLT+LGY+PG Sbjct: 26 NMPFTASDICKIILAVILPPLGVFLERGCGADLLINILLTLLGYLPG 72 >ref|XP_007338654.1| UPF0057-domain-containing protein [Auricularia delicata TFB-10046 SS5] gi|393245561|gb|EJD53071.1| UPF0057-domain-containing protein [Auricularia delicata TFB-10046 SS5] Length = 57 Score = 83.6 bits (205), Expect = 9e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 M TGSDICKI+FAI+LPP+GVF ERG GADFLINILLT+LGYIPG Sbjct: 1 MAFTGSDICKILFAILLPPLGVFFERGCGADFLINILLTVLGYIPG 46 >gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxysporum Fo5176] gi|517317170|emb|CCT69344.1| probable RIC1 protein [Fusarium fujikuroi IMI 58289] gi|584131311|gb|EWG40705.1| plasma membrane proteolipid 3 [Fusarium verticillioides 7600] gi|587668050|gb|EWY90391.1| plasma membrane proteolipid 3 [Fusarium oxysporum FOSC 3-a] gi|587690392|gb|EWZ36997.1| plasma membrane proteolipid 3 [Fusarium oxysporum Fo47] gi|587719003|gb|EWZ90340.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746858|gb|EXA44574.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037174|gb|EXK39032.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. melonis 26406] gi|590063000|gb|EXK90524.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. raphani 54005] gi|591421327|gb|EXL56464.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452771|gb|EXL85065.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470692|gb|EXM01996.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503744|gb|EXM33089.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 57 Score = 83.6 bits (205), Expect = 9e-14 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKI+ AIILPP+GVFLERG GADF INILLTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFFINILLTILGYIPG 46 >gb|EFX02834.1| stress response RCI peptide [Grosmannia clavigera kw1407] Length = 57 Score = 83.6 bits (205), Expect = 9e-14 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 M VTGSDICKII AIILPP+GVFLERG GAD LINILLTILGY+PG Sbjct: 1 MAVTGSDICKIILAIILPPLGVFLERGCGADLLINILLTILGYLPG 46 >gb|EFQ35058.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|530463481|gb|EQB46149.1| hypothetical protein CGLO_14841 [Colletotrichum gloeosporioides Cg-14] Length = 57 Score = 83.6 bits (205), Expect = 9e-14 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP T SDICKII AIILPP+GVFLERG GADF INILLTILGY+PG Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTILGYLPG 46 >gb|ETW85769.1| putative stress-induced hydrophobic peptide [Heterobasidion irregulare TC 32-1] Length = 57 Score = 83.2 bits (204), Expect = 1e-13 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 M TGSDICKIIFA++LPPIGVFLERG GAD +INILLTILGYIPG Sbjct: 1 MAFTGSDICKIIFAVLLPPIGVFLERGCGADLVINILLTILGYIPG 46 >gb|ENI09224.1| hypothetical protein COCC4DRAFT_68773 [Bipolaris maydis ATCC 48331] Length = 415 Score = 83.2 bits (204), Expect = 1e-13 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIP 588 MP T SDICKI+ AIILPPIGVFLERG GADFLINILLTILGYIP Sbjct: 1 MPFTASDICKILLAIILPPIGVFLERGCGADFLINILLTILGYIP 45 >gb|EME87335.1| hypothetical protein MYCFIDRAFT_180921 [Pseudocercospora fijiensis CIRAD86] Length = 57 Score = 83.2 bits (204), Expect = 1e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = +1 Query: 454 MPVTGSDICKIIFAIILPPIGVFLERGIGADFLINILLTILGYIPG 591 MP TGSDI KIIFAI+LPP+GVFLERG GAD LINILLTILGYIPG Sbjct: 1 MPFTGSDIIKIIFAILLPPLGVFLERGCGADLLINILLTILGYIPG 46