BLASTX nr result
ID: Paeonia25_contig00008987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00008987 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phas... 97 4e-18 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 97 4e-18 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 89 1e-15 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 88 2e-15 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 79 1e-12 ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833... 78 2e-12 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 75 1e-11 ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843... 73 7e-11 ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840... 72 1e-10 >ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] gi|561015106|gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 96.7 bits (239), Expect = 4e-18 Identities = 44/58 (75%), Positives = 51/58 (87%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 M+IFG H+ P QI+LF SGLLF ASTTYDVHRSIKNNQTPPS+EQ++AL+DYI S RR Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARR 58 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] gi|355517481|gb|AES99104.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 96.7 bits (239), Expect = 4e-18 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 M+IFG + PRQI+LF SGLLFLASTTYDVHRSIKNN+TPPS+EQ++ALE+YI SVRR Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRR 58 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 88.6 bits (218), Expect = 1e-15 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 MKIFG I RQI +F++G+LF A+TTYDVHRSIKNN+ PPS EQI+ALEDYI+SVRR Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVRR 58 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 87.8 bits (216), Expect = 2e-15 Identities = 36/55 (65%), Positives = 49/55 (89%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINS 358 M++FG H+ PRQI+LF +G++F +TTYDVHRSIKNN+ PP++EQ+EAL+DYINS Sbjct: 687 MRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINS 741 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 78.6 bits (192), Expect = 1e-12 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 M++ G H+ PRQI L +GL+F +TTYDVHRSIKNN PP++EQ+ AL+D+I+S +R Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRKR 58 >ref|XP_003578613.1| PREDICTED: uncharacterized protein LOC100833743 [Brachypodium distachyon] Length = 58 Score = 78.2 bits (191), Expect = 2e-12 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 M++ G H+ RQ+ LF +GL+F +TTYDVHRSIKNN PP++EQ+EAL+ YI+S +R Sbjct: 1 MRLLGKHVSARQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQQYIDSKKR 58 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 75.1 bits (183), Expect = 1e-11 Identities = 32/58 (55%), Positives = 45/58 (77%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 M++ G H+ PRQI+L +GL+F +TTYDVHRSIKNN PP+ EQ+ AL+ +I+S +R Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >ref|XP_003564165.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 83 Score = 72.8 bits (177), Expect = 7e-11 Identities = 31/52 (59%), Positives = 41/52 (78%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDY 367 M+ G H+ PRQ+ LF +GL+F +TTYDVHRSIKNN PP++EQ+EAL+ Y Sbjct: 1 MRPLGKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52 >ref|XP_003573896.1| PREDICTED: uncharacterized protein LOC100840032 [Brachypodium distachyon] Length = 58 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -3 Query: 522 MKIFGTHILPRQIMLFTSGLLFLASTTYDVHRSIKNNQTPPSKEQIEALEDYINSVRR 349 M+ H+ PRQ+ LF +GL+ TTYDVHRSIKNN P ++EQ+EAL++YI+S +R Sbjct: 1 MRPLDKHVSPRQVALFAAGLMLFGETTYDVHRSIKNNDQPSTREQMEALQEYIDSKKR 58