BLASTX nr result
ID: Paeonia25_contig00008912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00008912 (1316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD36210.1| hypothetical protein CERSUDRAFT_95557 [Ceriporiop... 62 7e-07 >gb|EMD36210.1| hypothetical protein CERSUDRAFT_95557 [Ceriporiopsis subvermispora B] Length = 357 Score = 61.6 bits (148), Expect = 7e-07 Identities = 41/75 (54%), Positives = 50/75 (66%), Gaps = 5/75 (6%) Frame = +2 Query: 611 QRAQLMRTSNKLGQLLGSTPHVIDLSYLPADPEPLRVDLTVRRIQPASHGPKAKGFFK-- 784 QRAQLMR+S+KLGQ+LGSTPHV+DLS P P PL V+L + PAS PK + FFK Sbjct: 22 QRAQLMRSSHKLGQVLGSTPHVLDLSLPP--PAPLHVELPFGK--PASK-PK-RSFFKSH 75 Query: 785 ---RKAPQLPTDDDE 820 R +P DDD+ Sbjct: 76 SRSRSSPFYDEDDDD 90