BLASTX nr result
ID: Paeonia25_contig00007091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00007091 (646 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007370459.1| hypothetical protein DICSQDRAFT_70739 [Dicho... 91 4e-16 gb|EIW54796.1| hypothetical protein TRAVEDRAFT_131331 [Trametes ... 88 2e-15 gb|EMD32318.1| hypothetical protein CERSUDRAFT_162060 [Ceriporio... 86 7e-15 gb|EPQ52370.1| hypothetical protein GLOTRDRAFT_65249 [Gloeophyll... 82 1e-13 ref|XP_007314152.1| hypothetical protein SERLADRAFT_433853 [Serp... 81 2e-13 gb|EPS98234.1| hypothetical protein FOMPIDRAFT_1126867 [Fomitops... 77 6e-12 emb|CCM06015.1| predicted protein [Fibroporia radiculosa] 69 1e-09 gb|EIW78292.1| hypothetical protein CONPUDRAFT_138629 [Coniophor... 69 2e-09 gb|ETW77804.1| hypothetical protein HETIRDRAFT_325970 [Heterobas... 68 2e-09 gb|ESK83017.1| hypothetical protein Moror_11751 [Moniliophthora ... 65 1e-08 ref|XP_007301883.1| hypothetical protein STEHIDRAFT_93994 [Stere... 65 2e-08 ref|XP_001881318.1| predicted protein [Laccaria bicolor S238N-H8... 65 2e-08 ref|XP_007271955.1| hypothetical protein FOMMEDRAFT_162532 [Fomi... 65 2e-08 ref|XP_003027545.1| hypothetical protein SCHCODRAFT_60897 [Schiz... 62 2e-07 ref|XP_007401336.1| hypothetical protein PHACADRAFT_178770 [Phan... 60 6e-07 gb|EJU00543.1| hypothetical protein DACRYDRAFT_80747, partial [D... 59 1e-06 ref|XP_007384150.1| hypothetical protein PUNSTDRAFT_52658 [Punct... 59 1e-06 >ref|XP_007370459.1| hypothetical protein DICSQDRAFT_70739 [Dichomitus squalens LYAD-421 SS1] gi|395324337|gb|EJF56779.1| hypothetical protein DICSQDRAFT_70739 [Dichomitus squalens LYAD-421 SS1] Length = 381 Score = 90.5 bits (223), Expect = 4e-16 Identities = 43/63 (68%), Positives = 52/63 (82%), Gaps = 1/63 (1%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPA-GAGTGADRKSLVSCLNGFFIP 179 +HPEAI LDYPY+TTL+PN +EIHSIET IVQ IPA +G +RK+L++CLNGFFIP Sbjct: 269 SHPEAISLDYPYLTTLMPNDTIEIHSIETQGIVQVIPAPSEESGENRKALIACLNGFFIP 328 Query: 180 STQ 188 STQ Sbjct: 329 STQ 331 >gb|EIW54796.1| hypothetical protein TRAVEDRAFT_131331 [Trametes versicolor FP-101664 SS1] Length = 374 Score = 88.2 bits (217), Expect = 2e-15 Identities = 42/66 (63%), Positives = 52/66 (78%), Gaps = 4/66 (6%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPA----GAGTGADRKSLVSCLNGF 170 +HPEA+ LDYPY+TTLLPNG VEIHS+E+ AIVQ I A + DRK+L++C+NGF Sbjct: 269 SHPEAVSLDYPYVTTLLPNGTVEIHSVESQAIVQVISAPPEGPSPLSGDRKALIACMNGF 328 Query: 171 FIPSTQ 188 FIPSTQ Sbjct: 329 FIPSTQ 334 >gb|EMD32318.1| hypothetical protein CERSUDRAFT_162060 [Ceriporiopsis subvermispora B] Length = 374 Score = 86.3 bits (212), Expect = 7e-15 Identities = 44/70 (62%), Positives = 53/70 (75%), Gaps = 8/70 (11%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPA-------GAG-TGADRKSLVSC 158 +HPEA+CLDYPYITTLLPN +EIHSIET AIVQ IPA G+G TG R++L++ Sbjct: 265 SHPEAVCLDYPYITTLLPNNTIEIHSIETQAIVQVIPAPPDSPGPGSGVTGTLRRTLLAS 324 Query: 159 LNGFFIPSTQ 188 NGF +PSTQ Sbjct: 325 ANGFLVPSTQ 334 >gb|EPQ52370.1| hypothetical protein GLOTRDRAFT_65249 [Gloeophyllum trabeum ATCC 11539] Length = 395 Score = 82.0 bits (201), Expect = 1e-13 Identities = 41/75 (54%), Positives = 53/75 (70%), Gaps = 13/75 (17%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGT-------------GADRK 143 +HPEA+CLDYPYITTLL NG++EIHSIET AIVQ IPA + + A R+ Sbjct: 275 SHPEAVCLDYPYITTLLSNGNIEIHSIETQAIVQVIPAPSTSPGPSPRSATFPVESAVRR 334 Query: 144 SLVSCLNGFFIPSTQ 188 +LV+C N +F+PST+ Sbjct: 335 NLVACANRYFVPSTK 349 >ref|XP_007314152.1| hypothetical protein SERLADRAFT_433853 [Serpula lacrymans var. lacrymans S7.9] gi|336375654|gb|EGO03990.1| hypothetical protein SERLA73DRAFT_69789 [Serpula lacrymans var. lacrymans S7.3] gi|336388766|gb|EGO29910.1| hypothetical protein SERLADRAFT_433853 [Serpula lacrymans var. lacrymans S7.9] Length = 330 Score = 81.3 bits (199), Expect = 2e-13 Identities = 40/72 (55%), Positives = 50/72 (69%), Gaps = 10/72 (13%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGA----------GTGADRKSLV 152 +HPEAICLDYPYI TLL NG +EIHS+ET +VQ +PA + G+ A R SLV Sbjct: 215 SHPEAICLDYPYIATLLVNGTIEIHSVETQELVQVVPAPSSSPSLSPSVEGSLAQRLSLV 274 Query: 153 SCLNGFFIPSTQ 188 +CLNG+ +PS Q Sbjct: 275 ACLNGYMVPSPQ 286 >gb|EPS98234.1| hypothetical protein FOMPIDRAFT_1126867 [Fomitopsis pinicola FP-58527 SS1] Length = 372 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/63 (58%), Positives = 45/63 (71%), Gaps = 1/63 (1%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGTGA-DRKSLVSCLNGFFIP 179 AHP++I LDYPYI TLLPN +EIHSI+TL IVQ +PA +RK L NGFF+P Sbjct: 268 AHPDSISLDYPYIATLLPNETIEIHSIDTLEIVQVVPAPTDAQVPERKKLAGSANGFFVP 327 Query: 180 STQ 188 S+Q Sbjct: 328 SSQ 330 >emb|CCM06015.1| predicted protein [Fibroporia radiculosa] Length = 437 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 7/62 (11%) Frame = +3 Query: 24 LDYPYITTLLPNGDVEIHSIETLAIVQSIPA-------GAGTGADRKSLVSCLNGFFIPS 182 LDYPYIT LLPNG V+IH+IET AI+Q + A G T DRK LV+C +GF +PS Sbjct: 342 LDYPYITALLPNGTVDIHNIETQAIMQVLSAPANSPMVGVSTVEDRKGLVACASGFLMPS 401 Query: 183 TQ 188 +Q Sbjct: 402 SQ 403 >gb|EIW78292.1| hypothetical protein CONPUDRAFT_138629 [Coniophora puteana RWD-64-598 SS2] Length = 380 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 6/67 (8%) Frame = +3 Query: 6 HPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPA------GAGTGADRKSLVSCLNG 167 HPEA+CLDYPYITTL+ G VEIH++ET I Q + A A R L +CL G Sbjct: 265 HPEAVCLDYPYITTLMQTGAVEIHNVETQIIAQVVSAPEPGSQDASVNMSRMGLKACLGG 324 Query: 168 FFIPSTQ 188 + +P++Q Sbjct: 325 YMVPTSQ 331 >gb|ETW77804.1| hypothetical protein HETIRDRAFT_325970 [Heterobasidion irregulare TC 32-1] Length = 389 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/72 (45%), Positives = 46/72 (63%), Gaps = 10/72 (13%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPA----------GAGTGADRKSLV 152 +HP A+CLDYPYITTLLPN +E+H+++T IVQ IPA + +R++L Sbjct: 266 SHPIALCLDYPYITTLLPNQTIEVHNLDTQTIVQVIPAPPLPLPSASPTSFLAQERRTLT 325 Query: 153 SCLNGFFIPSTQ 188 LNGF +PS + Sbjct: 326 ISLNGFLVPSQE 337 >gb|ESK83017.1| hypothetical protein Moror_11751 [Moniliophthora roreri MCA 2997] Length = 351 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/65 (43%), Positives = 45/65 (69%), Gaps = 3/65 (4%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAG---TGADRKSLVSCLNGFF 173 ++P+++C DYPY++TLLPN +EIH+++T +VQ +PA + +R L + L GF Sbjct: 269 SYPKSVCFDYPYVSTLLPNNTIEIHNVDTQGLVQVVPAPPEEDVSKEERSVLTTSLAGFL 328 Query: 174 IPSTQ 188 +PSTQ Sbjct: 329 VPSTQ 333 >ref|XP_007301883.1| hypothetical protein STEHIDRAFT_93994 [Stereum hirsutum FP-91666 SS1] gi|389747776|gb|EIM88954.1| hypothetical protein STEHIDRAFT_93994 [Stereum hirsutum FP-91666 SS1] Length = 464 Score = 65.1 bits (157), Expect = 2e-08 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 20/79 (25%) Frame = +3 Query: 6 HPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPA---------------GAGTGA-- 134 HP A+C DYPYITTLLP+ +EIHSIET A++Q+IPA G A Sbjct: 275 HPIAVCPDYPYITTLLPSQTIEIHSIETQALLQTIPAPPLPSPTLLSSSPSHGVNPAALM 334 Query: 135 ---DRKSLVSCLNGFFIPS 182 +R++L+ LNGF +P+ Sbjct: 335 MQNERRTLIRSLNGFVVPA 353 >ref|XP_001881318.1| predicted protein [Laccaria bicolor S238N-H82] gi|164643997|gb|EDR08248.1| predicted protein [Laccaria bicolor S238N-H82] Length = 374 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/91 (40%), Positives = 48/91 (52%), Gaps = 29/91 (31%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGTGA---------------- 134 +HPEA+CLDYP+ITTLLPNG +EIH+IET A+VQ I A + A Sbjct: 261 SHPEAVCLDYPHITTLLPNGTIEIHNIETQALVQVIGAPVISPAPTPRVSSPTVGHHKRA 320 Query: 135 -------------DRKSLVSCLNGFFIPSTQ 188 R +V+ L G+ +PSTQ Sbjct: 321 SSASVQSVTVNPGQRIGMVASLGGYLVPSTQ 351 >ref|XP_007271955.1| hypothetical protein FOMMEDRAFT_162532 [Fomitiporia mediterranea MF3/22] gi|393212225|gb|EJC97726.1| hypothetical protein FOMMEDRAFT_162532 [Fomitiporia mediterranea MF3/22] Length = 1083 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/62 (46%), Positives = 43/62 (69%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGTGADRKSLVSCLNGFFIPS 182 ++P ++C+DYPY+ LLPN +EIHSIET +VQ IP + + A +++V GF +PS Sbjct: 281 SYPVSLCMDYPYVAALLPNHTIEIHSIETQVVVQVIPDSSASEA--RAIVPSHTGFLVPS 338 Query: 183 TQ 188 TQ Sbjct: 339 TQ 340 >ref|XP_003027545.1| hypothetical protein SCHCODRAFT_60897 [Schizophyllum commune H4-8] gi|300101232|gb|EFI92642.1| hypothetical protein SCHCODRAFT_60897 [Schizophyllum commune H4-8] Length = 306 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/59 (44%), Positives = 41/59 (69%) Frame = +3 Query: 6 HPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGTGADRKSLVSCLNGFFIPS 182 +P +IC+D+PYI +LPN + +H+IET ++VQ+IP ++LVSCL G+ +PS Sbjct: 223 YPLSICMDFPYIVAVLPNNTIVVHNIETQSVVQTIPVPENLHV--RALVSCLEGYLVPS 279 >ref|XP_007401336.1| hypothetical protein PHACADRAFT_178770 [Phanerochaete carnosa HHB-10118-sp] gi|409040659|gb|EKM50146.1| hypothetical protein PHACADRAFT_178770 [Phanerochaete carnosa HHB-10118-sp] Length = 412 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/69 (42%), Positives = 44/69 (63%), Gaps = 7/69 (10%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGT-------GADRKSLVSCL 161 +HP ++ D P+ITTLL +G VEIH+IET A+VQ++P + DR +L++C Sbjct: 281 SHPVSVAFDDPHITTLLSDGTVEIHNIETQALVQTVPPSSSALTPAVPIPTDRTALLACS 340 Query: 162 NGFFIPSTQ 188 F +PST+ Sbjct: 341 ADFVVPSTE 349 >gb|EJU00543.1| hypothetical protein DACRYDRAFT_80747, partial [Dacryopinax sp. DJM-731 SS1] Length = 422 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/59 (44%), Positives = 41/59 (69%) Frame = +3 Query: 9 PEAICLDYPYITTLLPNGDVEIHSIETLAIVQSIPAGAGTGADRKSLVSCLNGFFIPST 185 P A+ +D+PY++ LLPNG V +HSIETL +VQ++ GA +++ S ++G + PST Sbjct: 306 PRALAVDWPYVSALLPNGTVVVHSIETLKVVQTVDVPVSLGA--RTMSSSMDGLYAPST 362 >ref|XP_007384150.1| hypothetical protein PUNSTDRAFT_52658 [Punctularia strigosozonata HHB-11173 SS5] gi|390598801|gb|EIN08198.1| hypothetical protein PUNSTDRAFT_52658 [Punctularia strigosozonata HHB-11173 SS5] Length = 361 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 2/62 (3%) Frame = +3 Query: 3 AHPEAICLDYPYITTLLPNGDVEIHSIETLAIVQSI--PAGAGTGADRKSLVSCLNGFFI 176 +HPEAI LDYPYI LLPN +EIH+IET IVQ I PA A +L + + + Sbjct: 264 SHPEAISLDYPYIVALLPNQTIEIHNIETQGIVQVISPPASASPQQTMTTLSTSAGRYLV 323 Query: 177 PS 182 PS Sbjct: 324 PS 325