BLASTX nr result
ID: Paeonia25_contig00006852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00006852 (544 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] 76 5e-12 >emb|CAN67479.1| hypothetical protein VITISV_035454 [Vitis vinifera] Length = 528 Score = 76.3 bits (186), Expect = 5e-12 Identities = 35/61 (57%), Positives = 42/61 (68%) Frame = -1 Query: 439 AVGLSIRPPFRFTLAPRFHSRHRHLDCRVAVNVHMSVLFVRDDNRRVGTGTDQGPYPCNG 260 A+G+SIRP RF L+P H R RHLD RV V+VHM +L VRD R G DQGP+ C+G Sbjct: 439 ALGVSIRPSLRFPLSPHLHRRRRHLDRRVVVDVHMPLLLVRDGTSRACAGADQGPHSCDG 498 Query: 259 V 257 V Sbjct: 499 V 499