BLASTX nr result
ID: Paeonia25_contig00006849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00006849 (523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW53257.1| hypothetical protein TRAVEDRAFT_133234 [Trametes ... 62 8e-08 gb|ETW77504.1| hypothetical protein HETIRDRAFT_411690 [Heterobas... 59 5e-07 ref|XP_007367362.1| hypothetical protein DICSQDRAFT_171630 [Dich... 57 2e-06 >gb|EIW53257.1| hypothetical protein TRAVEDRAFT_133234 [Trametes versicolor FP-101664 SS1] Length = 75 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 429 ASTLSPEARRWRTIMVCIPLIGATSLVLYQRLVLGKPRRTI 307 +S LSP+ARRWRTIM +P++G TS VLY+RLVLG+PRR + Sbjct: 2 SSKLSPQARRWRTIMFTLPIMGVTSFVLYKRLVLGEPRRVL 42 >gb|ETW77504.1| hypothetical protein HETIRDRAFT_411690 [Heterobasidion irregulare TC 32-1] Length = 88 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = -2 Query: 420 LSPEARRWRTIMVCIPLIGATSLVLYQRLVLGKPRRTIERPDERVQG 280 LSP+ +R RTI++ IP+I A+SLVLY+RLV GKP+RTI R E+ +G Sbjct: 6 LSPQGKRLRTIIITIPIIVASSLVLYERLVQGKPQRTISRTHEKGEG 52 >ref|XP_007367362.1| hypothetical protein DICSQDRAFT_171630 [Dichomitus squalens LYAD-421 SS1] gi|395327500|gb|EJF59899.1| hypothetical protein DICSQDRAFT_171630 [Dichomitus squalens LYAD-421 SS1] Length = 67 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -2 Query: 426 STLSPEARRWRTIMVCIPLIGATSLVLYQRLVLGKPRRTI 307 S L P+A+RWR I+ +P+IG TS VLY+RLVLG+PRRT+ Sbjct: 3 SKLPPQAQRWRIIIFTLPIIGVTSFVLYKRLVLGEPRRTL 42