BLASTX nr result
ID: Paeonia25_contig00006589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00006589 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAD92314.1| glutaminase GtaA [Byssochlamys spectabilis No. 5] 56 5e-06 >dbj|GAD92314.1| glutaminase GtaA [Byssochlamys spectabilis No. 5] Length = 688 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 2/78 (2%) Frame = +2 Query: 101 LSLHHILLYAPALLALTCVHAQETGFFPSAEPLAVRSPYL--WTALRAEQASLIATAGDW 274 + L H+ L A + L L + T P A PLAV+SPYL W ++ + AG+W Sbjct: 1 MKLCHLFLCALSQLTLAAAQSTFTPARPPAIPLAVKSPYLSTWINAGSDGGNGGYLAGEW 60 Query: 275 PVPYSGNTLGWAGLIRID 328 PV +S GWAGLIR+D Sbjct: 61 PVFWSNQITGWAGLIRVD 78