BLASTX nr result
ID: Paeonia25_contig00005879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00005879 (478 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABP02008.1| metallothionein [Ganoderma lucidum] 59 7e-07 ref|XP_002390765.1| hypothetical protein MPER_09911 [Moniliophth... 56 5e-06 >gb|ABP02008.1| metallothionein [Ganoderma lucidum] Length = 33 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +1 Query: 157 MFTTVEVPSNAAGCGSSTCNCGANCQCKPGECKC 258 M++T +V NAA CGSS+CNCGA C CKPGECKC Sbjct: 1 MYSTTDVVKNAA-CGSSSCNCGATCACKPGECKC 33 >ref|XP_002390765.1| hypothetical protein MPER_09911 [Moniliophthora perniciosa FA553] gi|215454559|gb|EEB91695.1| hypothetical protein MPER_09911 [Moniliophthora perniciosa FA553] Length = 33 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +1 Query: 148 ITTMFTTVEVPSNAAGCGSSTCNCGANCQCKPGECKC 258 I T FT V A CGSSTCNCG NC CKPGECKC Sbjct: 2 IATEFTVVN-----AHCGSSTCNCGENCACKPGECKC 33