BLASTX nr result
ID: Paeonia25_contig00005685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00005685 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS98875.1| hypothetical protein FOMPIDRAFT_1031190 [Fomitops... 58 1e-06 >gb|EPS98875.1| hypothetical protein FOMPIDRAFT_1031190 [Fomitopsis pinicola FP-58527 SS1] Length = 163 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +3 Query: 3 ESREVFGGAAAWLIRWFLVRKLQMGFDAMAGALKRRAEQLQQ 128 E+REV GG A+ IRWFL + LQ+GF A+A LK+RAEQLQ+ Sbjct: 122 ETREVMGGIGAYFIRWFLYKNLQLGFQAVADGLKKRAEQLQR 163