BLASTX nr result
ID: Paeonia25_contig00005272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00005272 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207851.1| hypothetical protein PRUPE_ppa022767mg [Prun... 59 7e-07 ref|XP_004511809.1| PREDICTED: phytosulfokines 3-like [Cicer ari... 57 2e-06 ref|XP_003539251.1| PREDICTED: phytosulfokines 3 [Glycine max] g... 56 5e-06 ref|XP_007018453.1| Phytosulfokines 3 precursor, putative [Theob... 55 8e-06 ref|XP_002525303.1| phytosulfokines precursor, putative [Ricinus... 55 8e-06 >ref|XP_007207851.1| hypothetical protein PRUPE_ppa022767mg [Prunus persica] gi|462403493|gb|EMJ09050.1| hypothetical protein PRUPE_ppa022767mg [Prunus persica] Length = 81 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 VVDMGCEGRRKEECLMRKTLEAHLDYIYTQKHNP 104 VV+ CEG +EECLMR+TL AH+DYIYTQKHNP Sbjct: 48 VVNESCEGAGEEECLMRRTLAAHVDYIYTQKHNP 81 >ref|XP_004511809.1| PREDICTED: phytosulfokines 3-like [Cicer arietinum] Length = 76 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 6 VDMGCEGRRKEECLMRKTLEAHLDYIYTQKHNP 104 VD CEG ++EECLMR+TL AH DYIYTQ HNP Sbjct: 44 VDESCEGLKEEECLMRRTLVAHTDYIYTQNHNP 76 >ref|XP_003539251.1| PREDICTED: phytosulfokines 3 [Glycine max] gi|255645823|gb|ACU23402.1| unknown [Glycine max] Length = 77 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +3 Query: 6 VDMGCEGRRKEECLMRKTLEAHLDYIYTQKHN 101 VD CEG ++EECL+R+TL AH+DYIYTQKHN Sbjct: 44 VDESCEGIKEEECLIRRTLTAHIDYIYTQKHN 75 >ref|XP_007018453.1| Phytosulfokines 3 precursor, putative [Theobroma cacao] gi|508723781|gb|EOY15678.1| Phytosulfokines 3 precursor, putative [Theobroma cacao] Length = 75 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +3 Query: 6 VDMGCEGRRKEECLMRKTLEAHLDYIYTQKHNP 104 +D CEG KEECLMR+TL AH+DYIYTQ H P Sbjct: 43 IDENCEGVGKEECLMRRTLAAHVDYIYTQNHKP 75 >ref|XP_002525303.1| phytosulfokines precursor, putative [Ricinus communis] gi|223535461|gb|EEF37131.1| phytosulfokines precursor, putative [Ricinus communis] Length = 87 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +3 Query: 3 VVDMGCEGRRKEECLMRKTLEAHLDYIYTQKHNP 104 +V+ CEG +EECLMR+TL AH+DYIYTQKH P Sbjct: 54 MVEESCEGVGEEECLMRRTLAAHIDYIYTQKHKP 87