BLASTX nr result
ID: Paeonia25_contig00005209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00005209 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD39073.1| hypothetical protein CERSUDRAFT_112775 [Ceriporio... 63 5e-08 gb|EPT01314.1| hypothetical protein FOMPIDRAFT_1023391 [Fomitops... 61 1e-07 gb|EPS94581.1| hypothetical protein FOMPIDRAFT_1108919, partial ... 61 1e-07 emb|CCM00260.1| predicted protein [Fibroporia radiculosa] 61 1e-07 ref|XP_007320707.1| hypothetical protein SERLADRAFT_451054 [Serp... 59 7e-07 gb|EIW58648.1| hypothetical protein TRAVEDRAFT_47790 [Trametes v... 58 1e-06 ref|XP_007401158.1| hypothetical protein PHACADRAFT_264420 [Phan... 57 3e-06 gb|EIW79239.1| hypothetical protein CONPUDRAFT_83513 [Coniophora... 57 3e-06 gb|EIW58644.1| hypothetical protein TRAVEDRAFT_29154 [Trametes v... 57 3e-06 ref|XP_007363053.1| hypothetical protein DICSQDRAFT_125261 [Dich... 57 3e-06 gb|ETW78977.1| hypothetical protein HETIRDRAFT_155992 [Heterobas... 55 8e-06 ref|XP_003032643.1| hypothetical protein SCHCODRAFT_75912 [Schiz... 55 8e-06 ref|XP_001831507.2| RhoGAP and Fes/CIP4 domain-containing protei... 55 8e-06 ref|XP_007386636.1| hypothetical protein PUNSTDRAFT_145491 [Punc... 55 1e-05 >gb|EMD39073.1| hypothetical protein CERSUDRAFT_112775 [Ceriporiopsis subvermispora B] Length = 1152 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPLTFQNSFWTQDYR GLEVLY QLE Sbjct: 1 MAVLSLPLTFQNSFWTQDYRKGLEVLYSQLE 31 >gb|EPT01314.1| hypothetical protein FOMPIDRAFT_1023391 [Fomitopsis pinicola FP-58527 SS1] Length = 1117 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPLTFQNSFW+QDYR+GLEVLY QLE Sbjct: 1 MAVLSLPLTFQNSFWSQDYRTGLEVLYAQLE 31 >gb|EPS94581.1| hypothetical protein FOMPIDRAFT_1108919, partial [Fomitopsis pinicola FP-58527 SS1] Length = 141 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPLTFQNSFW+QDYR+GLEVLY QLE Sbjct: 1 MAVLSLPLTFQNSFWSQDYRTGLEVLYTQLE 31 >emb|CCM00260.1| predicted protein [Fibroporia radiculosa] Length = 1153 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPLTFQNSFW+QDYR GLEVLY+QLE Sbjct: 1 MAVLSLPLTFQNSFWSQDYRRGLEVLYKQLE 31 >ref|XP_007320707.1| hypothetical protein SERLADRAFT_451054 [Serpula lacrymans var. lacrymans S7.9] gi|336368256|gb|EGN96599.1| hypothetical protein SERLA73DRAFT_170049 [Serpula lacrymans var. lacrymans S7.3] gi|336381017|gb|EGO22169.1| hypothetical protein SERLADRAFT_451054 [Serpula lacrymans var. lacrymans S7.9] Length = 1108 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPLTF NSFWTQDYR GLEVLY +LE Sbjct: 1 MAVLSLPLTFTNSFWTQDYRKGLEVLYSKLE 31 >gb|EIW58648.1| hypothetical protein TRAVEDRAFT_47790 [Trametes versicolor FP-101664 SS1] Length = 144 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLP TF NSFWTQDYR GLEVLY QLE Sbjct: 1 MAVLSLPTTFSNSFWTQDYRKGLEVLYGQLE 31 >ref|XP_007401158.1| hypothetical protein PHACADRAFT_264420 [Phanerochaete carnosa HHB-10118-sp] gi|409040473|gb|EKM49960.1| hypothetical protein PHACADRAFT_264420 [Phanerochaete carnosa HHB-10118-sp] Length = 1143 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAV++LP+TFQNSFW+QDYRSGL+VL+ QLE Sbjct: 1 MAVITLPVTFQNSFWSQDYRSGLQVLFNQLE 31 >gb|EIW79239.1| hypothetical protein CONPUDRAFT_83513 [Coniophora puteana RWD-64-598 SS2] Length = 1114 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPL F NSFWTQDYR GLEVLY +LE Sbjct: 1 MAVLSLPLNFTNSFWTQDYRKGLEVLYNKLE 31 >gb|EIW58644.1| hypothetical protein TRAVEDRAFT_29154 [Trametes versicolor FP-101664 SS1] Length = 1143 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLP TF NSFWTQDYR G+EVLY QLE Sbjct: 1 MAVLSLPTTFSNSFWTQDYRKGVEVLYGQLE 31 >ref|XP_007363053.1| hypothetical protein DICSQDRAFT_125261 [Dichomitus squalens LYAD-421 SS1] gi|395331862|gb|EJF64242.1| hypothetical protein DICSQDRAFT_125261 [Dichomitus squalens LYAD-421 SS1] Length = 1173 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPLTF NSFW++DYR GLEVLY +LE Sbjct: 1 MAVLSLPLTFSNSFWSEDYRKGLEVLYAELE 31 >gb|ETW78977.1| hypothetical protein HETIRDRAFT_155992 [Heterobasidion irregulare TC 32-1] Length = 1089 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPL+F NSFW+QDYR GL+VLY++LE Sbjct: 1 MAVLSLPLSFSNSFWSQDYRKGLDVLYKKLE 31 >ref|XP_003032643.1| hypothetical protein SCHCODRAFT_75912 [Schizophyllum commune H4-8] gi|300106337|gb|EFI97740.1| hypothetical protein SCHCODRAFT_75912 [Schizophyllum commune H4-8] Length = 1075 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPL+F NSFW+QDYR GLEVLY +LE Sbjct: 1 MAVLSLPLSFNNSFWSQDYRRGLEVLYTKLE 31 >ref|XP_001831507.2| RhoGAP and Fes/CIP4 domain-containing protein [Coprinopsis cinerea okayama7#130] gi|298406459|gb|EAU90354.2| RhoGAP and Fes/CIP4 domain-containing protein [Coprinopsis cinerea okayama7#130] Length = 1049 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLP+TF NSFW+QDYR GLEVL+++LE Sbjct: 1 MAVLSLPVTFNNSFWSQDYRRGLEVLFDKLE 31 >ref|XP_007386636.1| hypothetical protein PUNSTDRAFT_145491 [Punctularia strigosozonata HHB-11173 SS5] gi|390596767|gb|EIN06168.1| hypothetical protein PUNSTDRAFT_145491 [Punctularia strigosozonata HHB-11173 SS5] Length = 1112 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 98 MAVLSLPLTFQNSFWTQDYRSGLEVLYEQLE 6 MAVLSLPL+F NSFW+QDYR GLEVLY +LE Sbjct: 1 MAVLSLPLSFTNSFWSQDYRKGLEVLYGKLE 31