BLASTX nr result
ID: Paeonia25_contig00004405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00004405 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD41466.1| hypothetical protein CERSUDRAFT_128264 [Ceriporio... 65 8e-09 gb|EPQ61286.1| hypothetical protein GLOTRDRAFT_102895 [Gloeophyl... 64 2e-08 ref|XP_007390110.1| hypothetical protein PHACADRAFT_203822 [Phan... 64 3e-08 gb|EIW65111.1| hypothetical protein TRAVEDRAFT_55804 [Trametes v... 61 1e-07 ref|XP_001884587.1| predicted protein [Laccaria bicolor S238N-H8... 59 5e-07 ref|XP_007378092.1| hypothetical protein PUNSTDRAFT_139817 [Punc... 57 2e-06 gb|ESK93496.1| hypothetical protein Moror_1688 [Moniliophthora r... 57 3e-06 gb|ETW87717.1| hypothetical protein HETIRDRAFT_443350 [Heterobas... 55 8e-06 >gb|EMD41466.1| hypothetical protein CERSUDRAFT_128264 [Ceriporiopsis subvermispora B] Length = 774 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARYNVAN 139 S +DEA+RWFE++T +CRFVPDG TRAAK+S Y+ LLARY ++ Sbjct: 723 SLLDEAKRWFEAATTVCRFVPDGGTRAAKISDTYTHLLARYTTSH 767 >gb|EPQ61286.1| hypothetical protein GLOTRDRAFT_102895 [Gloeophyllum trabeum ATCC 11539] Length = 122 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARY 127 S +DEA+RWFE+ST +CR+VPDGE RA K+SA Y+ LL+RY Sbjct: 78 SLLDEAKRWFEASTVICRYVPDGEQRAEKISATYTHLLSRY 118 >ref|XP_007390110.1| hypothetical protein PHACADRAFT_203822 [Phanerochaete carnosa HHB-10118-sp] gi|409051186|gb|EKM60662.1| hypothetical protein PHACADRAFT_203822 [Phanerochaete carnosa HHB-10118-sp] Length = 1008 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARYNVAND 142 S DEARRWFE+ST +CRFVPDGE RA K+S Y+ LLA++ D Sbjct: 955 SLADEARRWFEASTVICRFVPDGEARAIKISETYTALLAKFRPGAD 1000 >gb|EIW65111.1| hypothetical protein TRAVEDRAFT_55804 [Trametes versicolor FP-101664 SS1] Length = 967 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = +2 Query: 2 TSAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARY 127 +S +DEA+RWFE +T +CRFVP GE+R+ K+SA Y+QLL RY Sbjct: 924 SSLLDEAKRWFELATTVCRFVPGGESRSEKISATYAQLLDRY 965 >ref|XP_001884587.1| predicted protein [Laccaria bicolor S238N-H82] gi|164640498|gb|EDR04763.1| predicted protein [Laccaria bicolor S238N-H82] Length = 126 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARY 127 S +DEA+RWFE+ST++CRFVP G+ RA K+S Y LL+RY Sbjct: 82 SLLDEAKRWFETSTRICRFVPGGKERAEKISDTYMHLLSRY 122 >ref|XP_007378092.1| hypothetical protein PUNSTDRAFT_139817 [Punctularia strigosozonata HHB-11173 SS5] gi|390603784|gb|EIN13175.1| hypothetical protein PUNSTDRAFT_139817 [Punctularia strigosozonata HHB-11173 SS5] Length = 957 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARYNV 133 S +DEA+RWFE ST +CR+VPDG RA K+S Y++LL+++ V Sbjct: 915 SLLDEAKRWFELSTVMCRYVPDGPQRAEKISDTYTKLLSQFTV 957 >gb|ESK93496.1| hypothetical protein Moror_1688 [Moniliophthora roreri MCA 2997] Length = 973 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLARYNVANDTQNP 154 S +DEA+RWFE+ST +C+FVP G RAA +S Y++LL+R+ TQ P Sbjct: 925 SLLDEAKRWFEASTMICKFVPGGAERAATISETYTRLLSRF-----TQEP 969 >gb|ETW87717.1| hypothetical protein HETIRDRAFT_443350 [Heterobasidion irregulare TC 32-1] Length = 785 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = +2 Query: 5 SAVDEARRWFESSTQLCRFVPDGETRAAKVSAAYSQLLAR 124 S ++EA+RWFE+S +CR+VPDGE RA KVS Y+ LL R Sbjct: 730 SLLEEAKRWFEASAVVCRYVPDGENRARKVSETYANLLDR 769