BLASTX nr result
ID: Paeonia25_contig00003485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00003485 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29235.1| hypothetical protein MIMGU_mgv1a013409mg [Mimulus... 175 7e-42 gb|EYU21949.1| hypothetical protein MIMGU_mgv1a011253mg [Mimulus... 175 7e-42 gb|EXB76287.1| GTP-binding nuclear protein Ran-3 [Morus notabilis] 175 7e-42 sp|P54765.1|RAN1A_LOTJA RecName: Full=GTP-binding nuclear protei... 175 7e-42 sp|P38548.1|RAN_VICFA RecName: Full=GTP-binding nuclear protein ... 175 7e-42 ref|NP_197501.1| GTP-binding nuclear protein Ran-1 [Arabidopsis ... 175 7e-42 gb|ADK73610.1| small GTP binding protein [Ipomoea batatas] 175 7e-42 gb|AHB38746.1| GTP-binding nuclear protein Ran3 [Prunus salicina] 175 7e-42 gb|AHB38745.1| GTP-binding nuclear protein Ran1 [Prunus salicina] 175 7e-42 ref|XP_007137047.1| hypothetical protein PHAVU_009G095400g [Phas... 175 7e-42 gb|AHA44507.1| GTP-binding nuclear protein Ran3E [Musa AB Group] 175 7e-42 gb|AHA44505.1| GTP-binding nuclear protein Ran3A, partial [Musa ... 175 7e-42 ref|XP_006451004.1| hypothetical protein CICLE_v10009426mg [Citr... 175 7e-42 ref|XP_006450497.1| hypothetical protein CICLE_v10009427mg [Citr... 175 7e-42 ref|XP_006841900.1| hypothetical protein AMTR_s00042p00113180 [A... 175 7e-42 ref|XP_006827532.1| hypothetical protein AMTR_s00009p00207870 [A... 175 7e-42 gb|AGV54526.1| Ras-like GTP-binding protein [Phaseolus vulgaris] 175 7e-42 ref|XP_007137048.1| hypothetical protein PHAVU_009G095500g [Phas... 175 7e-42 gb|AGS16676.1| GTP-binding nuclear protein Ran3E [Musa AB Group] 175 7e-42 ref|XP_007013338.1| RAN GTPase 3 [Theobroma cacao] gi|508783701|... 175 7e-42 >gb|EYU29235.1| hypothetical protein MIMGU_mgv1a013409mg [Mimulus guttatus] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|EYU21949.1| hypothetical protein MIMGU_mgv1a011253mg [Mimulus guttatus] Length = 288 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 103 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 162 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 163 TARLTYKNVPTWHRDLC 179 >gb|EXB76287.1| GTP-binding nuclear protein Ran-3 [Morus notabilis] Length = 302 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 117 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 176 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 177 TARLTYKNVPTWHRDLC 193 >sp|P54765.1|RAN1A_LOTJA RecName: Full=GTP-binding nuclear protein Ran1A gi|1370203|emb|CAA98187.1| RAN1A [Lotus japonicus] Length = 209 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 24 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 83 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 84 TARLTYKNVPTWHRDLC 100 >sp|P38548.1|RAN_VICFA RecName: Full=GTP-binding nuclear protein Ran/TC4 gi|395072|emb|CAA80845.1| guanine nucleotide regulatory protein [Vicia faba] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|NP_197501.1| GTP-binding nuclear protein Ran-1 [Arabidopsis thaliana] gi|1172833|sp|P41916.1|RAN1_ARATH RecName: Full=GTP-binding nuclear protein Ran-1; AltName: Full=Ras-related nuclear protein 1 gi|16226505|gb|AAL16185.1|AF428417_1 AT5g20010/F28I16_160 [Arabidopsis thaliana] gi|495729|gb|AAA32851.1| small ras-related protein [Arabidopsis thaliana] gi|2058278|emb|CAA66047.1| atran1 [Arabidopsis thaliana] gi|21618037|gb|AAM67087.1| RAN1 small Ras-like GTP-binding nuclear protein Ran-1 [Arabidopsis thaliana] gi|21928047|gb|AAM78052.1| AT5g20010/F28I16_160 [Arabidopsis thaliana] gi|332005396|gb|AED92779.1| GTP-binding nuclear protein Ran-1 [Arabidopsis thaliana] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|ADK73610.1| small GTP binding protein [Ipomoea batatas] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|AHB38746.1| GTP-binding nuclear protein Ran3 [Prunus salicina] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|AHB38745.1| GTP-binding nuclear protein Ran1 [Prunus salicina] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_007137047.1| hypothetical protein PHAVU_009G095400g [Phaseolus vulgaris] gi|593280979|ref|XP_007137049.1| hypothetical protein PHAVU_009G095600g [Phaseolus vulgaris] gi|498828040|gb|AGL52584.1| Ran1 [Hevea brasiliensis] gi|561010134|gb|ESW09041.1| hypothetical protein PHAVU_009G095400g [Phaseolus vulgaris] gi|561010136|gb|ESW09043.1| hypothetical protein PHAVU_009G095600g [Phaseolus vulgaris] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|AHA44507.1| GTP-binding nuclear protein Ran3E [Musa AB Group] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|AHA44505.1| GTP-binding nuclear protein Ran3A, partial [Musa AB Group] Length = 198 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_006451004.1| hypothetical protein CICLE_v10009426mg [Citrus clementina] gi|568843791|ref|XP_006475782.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Citrus sinensis] gi|557554230|gb|ESR64244.1| hypothetical protein CICLE_v10009426mg [Citrus clementina] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_006450497.1| hypothetical protein CICLE_v10009427mg [Citrus clementina] gi|568859574|ref|XP_006483313.1| PREDICTED: GTP-binding nuclear protein Ran-3-like [Citrus sinensis] gi|557553723|gb|ESR63737.1| hypothetical protein CICLE_v10009427mg [Citrus clementina] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_006841900.1| hypothetical protein AMTR_s00042p00113180 [Amborella trichopoda] gi|548843926|gb|ERN03575.1| hypothetical protein AMTR_s00042p00113180 [Amborella trichopoda] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_006827532.1| hypothetical protein AMTR_s00009p00207870 [Amborella trichopoda] gi|548832152|gb|ERM94948.1| hypothetical protein AMTR_s00009p00207870 [Amborella trichopoda] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|AGV54526.1| Ras-like GTP-binding protein [Phaseolus vulgaris] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_007137048.1| hypothetical protein PHAVU_009G095500g [Phaseolus vulgaris] gi|543176968|gb|AGV54506.1| GTP-binding nuclear protein Ran-3 [Phaseolus vulgaris] gi|543177251|gb|AGV54647.1| Ras-like GTP-binding protein 3G-1 [Phaseolus vulgaris] gi|561010135|gb|ESW09042.1| hypothetical protein PHAVU_009G095500g [Phaseolus vulgaris] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >gb|AGS16676.1| GTP-binding nuclear protein Ran3E [Musa AB Group] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112 >ref|XP_007013338.1| RAN GTPase 3 [Theobroma cacao] gi|508783701|gb|EOY30957.1| RAN GTPase 3 [Theobroma cacao] Length = 221 Score = 175 bits (443), Expect = 7e-42 Identities = 77/77 (100%), Positives = 77/77 (100%) Frame = -2 Query: 232 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 53 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV Sbjct: 36 GEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDV 95 Query: 52 TARLTYKNVPTWHRDLC 2 TARLTYKNVPTWHRDLC Sbjct: 96 TARLTYKNVPTWHRDLC 112