BLASTX nr result
ID: Paeonia25_contig00003344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00003344 (1508 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD34412.1| hypothetical protein CERSUDRAFT_97671 [Ceriporiop... 62 5e-07 gb|EIW51724.1| hypothetical protein TRAVEDRAFT_32241 [Trametes v... 59 4e-06 >gb|EMD34412.1| hypothetical protein CERSUDRAFT_97671 [Ceriporiopsis subvermispora B] Length = 137 Score = 62.4 bits (150), Expect = 5e-07 Identities = 31/57 (54%), Positives = 38/57 (66%) Frame = +1 Query: 964 EPPFPSFTLVLTTAEHEISDFRLPPYCSKHLGRYHPYPRSGAPPQDCLMQTVDYRYA 1134 EP +PS LVL+ + S RLP Y S +LGRYHPYP++ D LMQTVDYRY+ Sbjct: 5 EPSYPSIDLVLSNGGSDTS--RLPSYRSSYLGRYHPYPQTRRRASDRLMQTVDYRYS 59 >gb|EIW51724.1| hypothetical protein TRAVEDRAFT_32241 [Trametes versicolor FP-101664 SS1] Length = 154 Score = 59.3 bits (142), Expect = 4e-06 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +1 Query: 958 RPEPPFPSFTLVLTTA-EHEISDFRLPPYCSKHLGRYHPYPR-SGAPPQDCLMQTVDYRY 1131 R +PP+PSFT VL+ RLP Y + H+GRYHPY R + + QD LM T+DYRY Sbjct: 3 RIDPPYPSFTFVLSKPLPRNDRSSRLPAYRASHMGRYHPYARVAPSQCQDRLMTTIDYRY 62 Query: 1132 A 1134 A Sbjct: 63 A 63