BLASTX nr result
ID: Paeonia25_contig00001776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00001776 (2307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD37845.1| hypothetical protein CERSUDRAFT_114488 [Ceriporio... 66 8e-08 >gb|EMD37845.1| hypothetical protein CERSUDRAFT_114488 [Ceriporiopsis subvermispora B] Length = 780 Score = 65.9 bits (159), Expect = 8e-08 Identities = 29/63 (46%), Positives = 41/63 (65%) Frame = -3 Query: 2185 FAAYVVIVGTEPGIYDTWGDTARRVLTVPGSIYHGCTTRANAEETYERARRAGDVRKVGK 2006 +AAYVV VG+EPG+Y+ WG+ R+ V G++++G TR AEE +E R G VR V Sbjct: 4 YAAYVVFVGSEPGVYNDWGEVGMRISGVKGALFNGYATRIEAEEAFENVRMQGGVRTVRT 63 Query: 2005 NGR 1997 + R Sbjct: 64 DRR 66