BLASTX nr result
ID: Paeonia25_contig00001523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00001523 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625984.1| Receptor-like protein kinase [Medicago trunc... 76 6e-12 ref|XP_004494430.1| PREDICTED: receptor-like serine/threonine-pr... 74 3e-11 ref|XP_002270928.1| PREDICTED: receptor-like serine/threonine-pr... 73 4e-11 ref|XP_002515269.1| kinase, putative [Ricinus communis] gi|22354... 73 4e-11 emb|CAN74588.1| hypothetical protein VITISV_041991 [Vitis vinifera] 73 4e-11 ref|XP_002320287.2| hypothetical protein POPTR_0014s11430g [Popu... 72 8e-11 ref|XP_006444512.1| hypothetical protein CICLE_v10019041mg [Citr... 72 1e-10 gb|EXB28575.1| Receptor-like serine/threonine-protein kinase [Mo... 70 2e-10 ref|XP_006492351.1| PREDICTED: receptor-like serine/threonine-pr... 70 3e-10 ref|XP_006492350.1| PREDICTED: receptor-like serine/threonine-pr... 70 3e-10 ref|XP_007145140.1| hypothetical protein PHAVU_007G213400g [Phas... 70 3e-10 ref|XP_004156817.1| PREDICTED: receptor-like serine/threonine-pr... 70 4e-10 ref|XP_004152220.1| PREDICTED: receptor-like serine/threonine-pr... 70 4e-10 ref|XP_006588370.1| PREDICTED: NAK-like ser/thr protein kinase i... 67 2e-09 ref|XP_002302774.2| hypothetical protein POPTR_0002s19550g [Popu... 67 2e-09 ref|NP_001235388.1| NAK-like ser/thr protein kinase [Glycine max... 67 2e-09 ref|XP_004495897.1| PREDICTED: receptor-like serine/threonine-pr... 67 3e-09 ref|XP_004288568.1| PREDICTED: receptor-like serine/threonine-pr... 67 3e-09 ref|XP_003591387.1| Protein kinase 2B [Medicago truncatula] gi|3... 67 3e-09 ref|XP_006604746.1| PREDICTED: receptor-like serine/threonine-pr... 66 4e-09 >ref|XP_003625984.1| Receptor-like protein kinase [Medicago truncatula] gi|355500999|gb|AES82202.1| Receptor-like protein kinase [Medicago truncatula] Length = 725 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FDNDNISRT VFSEDLHEGR Sbjct: 688 DGTSSVFSSGPYSGLSAAFDNDNISRTVVFSEDLHEGR 725 >ref|XP_004494430.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Cicer arietinum] Length = 722 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FD DNISRT VFSEDLHEGR Sbjct: 685 DGTSSVFSSGPYSGLSAAFDTDNISRTVVFSEDLHEGR 722 >ref|XP_002270928.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2 [Vitis vinifera] gi|297743991|emb|CBI36961.3| unnamed protein product [Vitis vinifera] Length = 707 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSSIFSSGPYSGLSA FDNDNISRTAVFSEDLHEGR Sbjct: 671 DGTSSIFSSGPYSGLSA-FDNDNISRTAVFSEDLHEGR 707 >ref|XP_002515269.1| kinase, putative [Ricinus communis] gi|223545749|gb|EEF47253.1| kinase, putative [Ricinus communis] Length = 711 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSSIFSSGPYSGLSA FDNDNISRTAVFSEDLHEGR Sbjct: 675 DGTSSIFSSGPYSGLSA-FDNDNISRTAVFSEDLHEGR 711 >emb|CAN74588.1| hypothetical protein VITISV_041991 [Vitis vinifera] Length = 707 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSSIFSSGPYSGLSA FDNDNISRTAVFSEDLHEGR Sbjct: 671 DGTSSIFSSGPYSGLSA-FDNDNISRTAVFSEDLHEGR 707 >ref|XP_002320287.2| hypothetical protein POPTR_0014s11430g [Populus trichocarpa] gi|550323991|gb|EEE98602.2| hypothetical protein POPTR_0014s11430g [Populus trichocarpa] Length = 733 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FDNDNISRTAVFSEDLHEGR Sbjct: 697 DGTSSMFSSGPYSGLSA-FDNDNISRTAVFSEDLHEGR 733 >ref|XP_006444512.1| hypothetical protein CICLE_v10019041mg [Citrus clementina] gi|557546774|gb|ESR57752.1| hypothetical protein CICLE_v10019041mg [Citrus clementina] Length = 726 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FDNDN+SRTAVFSEDLHEGR Sbjct: 690 DGTSSMFSSGPYSGLSA-FDNDNVSRTAVFSEDLHEGR 726 >gb|EXB28575.1| Receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 746 Score = 70.5 bits (171), Expect = 2e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGP+SGLSA FDNDNISRTAVFSEDLHEGR Sbjct: 710 DGTSSMFSSGPFSGLSA-FDNDNISRTAVFSEDLHEGR 746 >ref|XP_006492351.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like isoform X2 [Citrus sinensis] Length = 726 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FDN+N+SRTAVFSEDLHEGR Sbjct: 690 DGTSSMFSSGPYSGLSA-FDNENVSRTAVFSEDLHEGR 726 >ref|XP_006492350.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like isoform X1 [Citrus sinensis] Length = 735 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FDN+N+SRTAVFSEDLHEGR Sbjct: 699 DGTSSMFSSGPYSGLSA-FDNENVSRTAVFSEDLHEGR 735 >ref|XP_007145140.1| hypothetical protein PHAVU_007G213400g [Phaseolus vulgaris] gi|561018330|gb|ESW17134.1| hypothetical protein PHAVU_007G213400g [Phaseolus vulgaris] Length = 695 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FD+DNISRTAVFSEDLHEGR Sbjct: 659 DGTSSMFSSGPYSGLSA-FDHDNISRTAVFSEDLHEGR 695 >ref|XP_004156817.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Cucumis sativus] Length = 723 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DG+SS+FSSGPYSGLSA FDNDN+SRTA+FSEDLHEGR Sbjct: 687 DGSSSMFSSGPYSGLSA-FDNDNVSRTAIFSEDLHEGR 723 >ref|XP_004152220.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Cucumis sativus] Length = 723 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DG+SS+FSSGPYSGLSA FDNDN+SRTA+FSEDLHEGR Sbjct: 687 DGSSSMFSSGPYSGLSA-FDNDNVSRTAIFSEDLHEGR 723 >ref|XP_006588370.1| PREDICTED: NAK-like ser/thr protein kinase isoform X1 [Glycine max] Length = 697 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLS FD DNISRTAVFSEDLHEGR Sbjct: 661 DGTSSMFSSGPYSGLST-FDYDNISRTAVFSEDLHEGR 697 >ref|XP_002302774.2| hypothetical protein POPTR_0002s19550g [Populus trichocarpa] gi|550345394|gb|EEE82047.2| hypothetical protein POPTR_0002s19550g [Populus trichocarpa] Length = 733 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYS LSA DNDNISRTAVFSEDLHEGR Sbjct: 697 DGTSSMFSSGPYSSLSA-LDNDNISRTAVFSEDLHEGR 733 >ref|NP_001235388.1| NAK-like ser/thr protein kinase [Glycine max] gi|223452482|gb|ACM89568.1| NAK-like ser/thr protein kinase [Glycine max] Length = 568 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLS FD DNISRTAVFSEDLHEGR Sbjct: 532 DGTSSMFSSGPYSGLST-FDYDNISRTAVFSEDLHEGR 568 >ref|XP_004495897.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Cicer arietinum] Length = 664 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLS FD DNISRTAVFSEDLHEGR Sbjct: 628 DGTSSMFSSGPYSGLSP-FDYDNISRTAVFSEDLHEGR 664 >ref|XP_004288568.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like [Fragaria vesca subsp. vesca] Length = 682 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 D +SS+FSSGPYSGLSA FDNDNISRTAVFSEDLHEGR Sbjct: 646 DVSSSMFSSGPYSGLSA-FDNDNISRTAVFSEDLHEGR 682 >ref|XP_003591387.1| Protein kinase 2B [Medicago truncatula] gi|355480435|gb|AES61638.1| Protein kinase 2B [Medicago truncatula] Length = 630 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DG SS+FSSGPYSGLSA FD DNISRTAVFSEDLHEGR Sbjct: 594 DGASSMFSSGPYSGLSA-FDYDNISRTAVFSEDLHEGR 630 >ref|XP_006604746.1| PREDICTED: receptor-like serine/threonine-protein kinase ALE2-like isoform X2 [Glycine max] Length = 682 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -1 Query: 407 DGTSSIFSSGPYSGLSAGFDNDNISRTAVFSEDLHEGR 294 DGTSS+FSSGPYSGLSA FDNDNISRT VFSEDL EGR Sbjct: 646 DGTSSMFSSGPYSGLSA-FDNDNISRTVVFSEDLCEGR 682