BLASTX nr result
ID: Paeonia24_contig00042397
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00042397 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006847006.1| hypothetical protein AMTR_s00017p00141460 [A... 57 3e-06 >ref|XP_006847006.1| hypothetical protein AMTR_s00017p00141460 [Amborella trichopoda] gi|548850035|gb|ERN08587.1| hypothetical protein AMTR_s00017p00141460 [Amborella trichopoda] Length = 967 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/48 (62%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = -2 Query: 260 KIIANGGKIILN*DDNCILTGGDGVFVIAEDDVTYA----PDQRCGFY 129 K++ANGGKI+LN DDN IL GD V VIAEDD TYA P+ R GF+ Sbjct: 636 KVVANGGKIVLNPDDNYILKEGDEVLVIAEDDDTYAPGPLPEVRRGFH 683