BLASTX nr result
ID: Paeonia24_contig00042165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00042165 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34375.3| unnamed protein product [Vitis vinifera] 121 9e-26 ref|XP_007209027.1| hypothetical protein PRUPE_ppa023983mg, part... 105 7e-21 ref|XP_007040331.1| Pentatricopeptide repeat superfamily protein... 100 2e-19 ref|XP_002299515.2| hypothetical protein POPTR_0001s09740g, part... 95 1e-17 ref|XP_006476514.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-16 ref|XP_006439492.1| hypothetical protein CICLE_v10018905mg [Citr... 88 1e-15 emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] 70 3e-10 ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_002521565.1| pentatricopeptide repeat-containing protein,... 67 3e-09 ref|XP_006829037.1| hypothetical protein AMTR_s00001p00253810 [A... 66 4e-09 ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citr... 62 6e-08 ref|XP_004500589.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 62 1e-07 ref|XP_006403701.1| hypothetical protein EUTSA_v10010938mg [Eutr... 60 2e-07 ref|XP_004301150.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_004144616.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_002531691.1| pentatricopeptide repeat-containing protein,... 60 2e-07 emb|CBI22269.3| unnamed protein product [Vitis vinifera] 60 3e-07 ref|XP_007140702.1| hypothetical protein PHAVU_008G134600g [Phas... 59 5e-07 ref|XP_002317690.2| pentatricopeptide repeat-containing family p... 59 5e-07 ref|XP_002310070.2| hypothetical protein POPTR_0007s07610g [Popu... 59 9e-07 >emb|CBI34375.3| unnamed protein product [Vitis vinifera] Length = 814 Score = 121 bits (304), Expect = 9e-26 Identities = 61/99 (61%), Positives = 78/99 (78%) Frame = -2 Query: 299 LVTRGLYPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLR 120 LV + LYP+AL+AS+S P LTDQ+YALFLKSGF LD FL++ +++RF+ SGDF+R+ R Sbjct: 17 LVLKRLYPQALRASASLLHPPLTDQSYALFLKSGFALDAFLSSFIVNRFAISGDFARARR 76 Query: 119 FLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLRSS 3 FLLD+ PDTV+WN+LISG+AR Q FDLFN LR S Sbjct: 77 FLLDTPYPDTVSWNSLISGYARFRQPGPVFDLFNGLRRS 115 >ref|XP_007209027.1| hypothetical protein PRUPE_ppa023983mg, partial [Prunus persica] gi|462404762|gb|EMJ10226.1| hypothetical protein PRUPE_ppa023983mg, partial [Prunus persica] Length = 697 Score = 105 bits (262), Expect = 7e-21 Identities = 57/99 (57%), Positives = 75/99 (75%), Gaps = 2/99 (2%) Frame = -2 Query: 299 LVTRGLYPEALKASSSS--FSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRS 126 L+ +GLYPEAL+AS+S+ +P LT+QTYALFLKSG LD FLA+ +I +F+ G F + Sbjct: 13 LLRQGLYPEALQASTSTSPLNPFLTNQTYALFLKSGHRLDPFLASAVISQFAKLGLFYHA 72 Query: 125 LRFLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLR 9 L+FL D+ DPDTV++NALI+G AR G FDLF+RLR Sbjct: 73 LQFLNDTPDPDTVSYNALIAGLARSGPPGPVFDLFDRLR 111 >ref|XP_007040331.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508777576|gb|EOY24832.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 811 Score = 100 bits (249), Expect = 2e-19 Identities = 51/97 (52%), Positives = 69/97 (71%) Frame = -2 Query: 299 LVTRGLYPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLR 120 L+T+ L+P+AL+ S S P LTDQ Y+ F+KSG L+ FL +TL+ FS DFSR+L Sbjct: 18 LITQNLHPQALRNSLSYHFPLLTDQIYSHFIKSGHSLNPFLCSTLVSHFSKHADFSRALS 77 Query: 119 FLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLR 9 F LD+ PDTV++N+LISG AR G++ F+LFN LR Sbjct: 78 FFLDTPKPDTVSFNSLISGFARSGRTGPVFELFNGLR 114 >ref|XP_002299515.2| hypothetical protein POPTR_0001s09740g, partial [Populus trichocarpa] gi|550346914|gb|EEE84320.2| hypothetical protein POPTR_0001s09740g, partial [Populus trichocarpa] Length = 706 Score = 94.7 bits (234), Expect = 1e-17 Identities = 49/102 (48%), Positives = 67/102 (65%), Gaps = 5/102 (4%) Frame = -2 Query: 299 LVTRGLYPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFS-----NSGDF 135 L+++ YP+ALK+S + P LTDQTY+LF+KSG LD +++T LI FS N+ + Sbjct: 19 LISQKGYPQALKSSLTLSCPLLTDQTYSLFIKSGHFLDPYVSTALISHFSKLHNNNNNNL 78 Query: 134 SRSLRFLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLR 9 SRSL F LD+ +PD + +NA+ISG AR S LFN LR Sbjct: 79 SRSLSFFLDTQNPDIITYNAIISGFARANDSRTVLGLFNELR 120 >ref|XP_006476514.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Citrus sinensis] Length = 801 Score = 90.9 bits (224), Expect = 2e-16 Identities = 48/97 (49%), Positives = 65/97 (67%) Frame = -2 Query: 299 LVTRGLYPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLR 120 L+ + + +ALK+S + SP LTDQ Y+L +K+G LD L+TTLI F+ DF R+ R Sbjct: 18 LLNQNNHSQALKSSLALLSPLLTDQIYSLLIKNGHHLDPILSTTLISHFTKFADFRRAFR 77 Query: 119 FLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLR 9 FL D+ +PD + +NALISG AR QS A LF+RLR Sbjct: 78 FLFDTQNPDIITYNALISGLARFCQSGPALKLFDRLR 114 >ref|XP_006439492.1| hypothetical protein CICLE_v10018905mg [Citrus clementina] gi|557541754|gb|ESR52732.1| hypothetical protein CICLE_v10018905mg [Citrus clementina] Length = 801 Score = 88.2 bits (217), Expect = 1e-15 Identities = 47/97 (48%), Positives = 64/97 (65%) Frame = -2 Query: 299 LVTRGLYPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLR 120 L+ + + +ALK+S + SP LTDQ Y+L +K+G LD L+TTLI F+ DF R+ R Sbjct: 18 LLNQNNHSQALKSSLAQLSPLLTDQIYSLLIKNGHHLDPILSTTLISHFTKFADFRRAFR 77 Query: 119 FLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLR 9 FL D+ + D + +NALISG AR QS A LF+RLR Sbjct: 78 FLFDTQNRDIITYNALISGLARFCQSGPALKLFDRLR 114 >emb|CAN66581.1| hypothetical protein VITISV_030261 [Vitis vinifera] Length = 622 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/91 (38%), Positives = 57/91 (62%), Gaps = 1/91 (1%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 +P LKA SS + T Q +A +K GF + + +L++ +S SGD +S R L D Sbjct: 121 FPFLLKACSSMSASEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGDI-KSARLLFDQV 179 Query: 101 DP-DTVAWNALISGHARCGQSELAFDLFNRL 12 D DTV+WN++I G+ +CG+ E+A+++FN + Sbjct: 180 DQRDTVSWNSMIDGYTKCGEIEMAYEIFNHM 210 >ref|XP_002272744.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 622 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/91 (38%), Positives = 57/91 (62%), Gaps = 1/91 (1%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 +P LKA SS + T Q +A +K GF + + +L++ +S SGD +S R L D Sbjct: 121 FPFLLKACSSMSALEETQQIHAHIIKMGFGSEIYTTNSLLNVYSKSGDI-KSARLLFDQV 179 Query: 101 DP-DTVAWNALISGHARCGQSELAFDLFNRL 12 D DTV+WN++I G+ +CG+ E+A+++FN + Sbjct: 180 DQRDTVSWNSMIDGYTKCGEIEMAYEIFNHM 210 >ref|XP_002521565.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539243|gb|EEF40836.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 338 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/88 (38%), Positives = 53/88 (60%), Gaps = 1/88 (1%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDS- 105 +P LKA SS + Q +A +K GF D + +L+H ++ SG F S R + D Sbjct: 114 FPFLLKACSSLSAIEKAQQVHAQIIKLGFGSDVYTTNSLLHAYAASG-FIESARIIFDRI 172 Query: 104 HDPDTVAWNALISGHARCGQSELAFDLF 21 PDTV+WN++I G+ +CG++E A++LF Sbjct: 173 PHPDTVSWNSIIDGYVKCGETETAYELF 200 >ref|XP_006829037.1| hypothetical protein AMTR_s00001p00253810 [Amborella trichopoda] gi|548834016|gb|ERM96453.1| hypothetical protein AMTR_s00001p00253810 [Amborella trichopoda] Length = 680 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/98 (36%), Positives = 58/98 (59%), Gaps = 1/98 (1%) Frame = -2 Query: 299 LVTRGLYPEALKASSSSFSPH-LTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSL 123 L+ LYP+ + AS SS S L Q Y +KS F L+ + +++L++ F+ G+ + Sbjct: 57 LMNHNLYPQDITASKSSLSDQSLMPQIYCYLIKSSFPLNKYQSSSLVNIFAKYGNLQLAH 116 Query: 122 RFLLDSHDPDTVAWNALISGHARCGQSELAFDLFNRLR 9 LL+S D DTV+WN+LIS +A + +F LF+ L+ Sbjct: 117 ELLLNSPDTDTVSWNSLISVYADIKDTHFSFGLFDSLQ 154 >ref|XP_006425654.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] gi|568824869|ref|XP_006466814.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Citrus sinensis] gi|557527644|gb|ESR38894.1| hypothetical protein CICLE_v10025166mg [Citrus clementina] Length = 622 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/93 (36%), Positives = 54/93 (58%), Gaps = 2/93 (2%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 +P LKA S + T Q +A +K GF + F +L+H ++ SG +S R + D H Sbjct: 121 FPFLLKACSRLSALEETQQIHAQIIKFGFSSEVFATNSLLHAYAISGSI-KSARLIFD-H 178 Query: 101 DP--DTVAWNALISGHARCGQSELAFDLFNRLR 9 P DTV+WN++I G+ +CG+ ELA + F ++ Sbjct: 179 MPQRDTVSWNSMIDGYTKCGEMELACEFFKDMK 211 >ref|XP_004500589.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g08210-like [Cicer arietinum] Length = 748 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/84 (38%), Positives = 48/84 (57%) Frame = -2 Query: 272 ALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSHDPD 93 ALK + +P L Q + L + SG+ LD + + LI ++ G+ + +LR D D Sbjct: 348 ALKICVNFTNPSLASQVHGLVITSGYELDCIVGSILIDLYAKQGNINNALRLFERLPDKD 407 Query: 92 TVAWNALISGHARCGQSELAFDLF 21 VAW++LI+G AR G +LAF LF Sbjct: 408 VVAWSSLIAGCARFGSDKLAFSLF 431 >ref|XP_006403701.1| hypothetical protein EUTSA_v10010938mg [Eutrema salsugineum] gi|557104820|gb|ESQ45154.1| hypothetical protein EUTSA_v10010938mg [Eutrema salsugineum] Length = 768 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/94 (32%), Positives = 49/94 (52%) Frame = -2 Query: 284 LYPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDS 105 +Y +LKA S+ P Q + L +KSGF D F +L ++ G S + R Sbjct: 272 IYGSSLKACSNLLRPDYGSQIHGLCIKSGFSGDAFAGCSLCDMYARCGFLSSARRVFYQI 331 Query: 104 HDPDTVAWNALISGHARCGQSELAFDLFNRLRSS 3 PDT +WN +I+G A G ++ A F+++R+S Sbjct: 332 EKPDTASWNVIIAGLANNGYADEAVSFFSQMRNS 365 >ref|XP_004301150.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 892 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/90 (33%), Positives = 51/90 (56%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 Y L A ++ +P L Q Y+L K+GF + ++ + +I F+ +G F +LR D Sbjct: 150 YGSVLSACAALRAPGLGKQVYSLATKNGFFSNDYVRSGMIDLFAKNGSFEDALRVFCDVS 209 Query: 101 DPDTVAWNALISGHARCGQSELAFDLFNRL 12 + V WNALISG R G++ +A ++F ++ Sbjct: 210 CRNVVIWNALISGAVRNGENRVALEIFRQM 239 >ref|XP_004144616.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449511814|ref|XP_004164061.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 681 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/72 (37%), Positives = 43/72 (59%) Frame = -2 Query: 227 QTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSHDPDTVAWNALISGHARCG 48 Q + L LK GF +D F+ ++L+ +S G+ + D D V+WN+LI G+ARCG Sbjct: 135 QIHGLVLKIGFGVDKFVLSSLVSMYSKCGEIELCRKVFDRMEDKDVVSWNSLIDGYARCG 194 Query: 47 QSELAFDLFNRL 12 + ELA ++F + Sbjct: 195 EIELALEMFEEM 206 >ref|XP_002531691.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528667|gb|EEF30682.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 434 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/72 (37%), Positives = 43/72 (59%) Frame = -2 Query: 227 QTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSHDPDTVAWNALISGHARCG 48 Q + L LK GF L+ F++++L++ +S D + + L D D V+WN+LI G+ +CG Sbjct: 128 QIHGLVLKLGFGLNKFVSSSLVNMYSKCKDIDSAKKVFLSMDDKDLVSWNSLIDGYVKCG 187 Query: 47 QSELAFDLFNRL 12 Q EL LF + Sbjct: 188 QVELGMKLFEEM 199 >emb|CBI22269.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/90 (31%), Positives = 47/90 (52%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 YP LKA S + + +A K GF LD F+ +LI + G+ + R + Sbjct: 118 YPFLLKACSGKVWVRVVEMIHAQVEKMGFCLDIFVPNSLIDSYFKLGELGEARRLFDEMP 177 Query: 101 DPDTVAWNALISGHARCGQSELAFDLFNRL 12 + DTV+WN ++ G+ + G+ AF+LF ++ Sbjct: 178 ERDTVSWNTILDGYVKAGEMNAAFELFEKM 207 >ref|XP_007140702.1| hypothetical protein PHAVU_008G134600g [Phaseolus vulgaris] gi|561013835|gb|ESW12696.1| hypothetical protein PHAVU_008G134600g [Phaseolus vulgaris] Length = 902 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/90 (32%), Positives = 50/90 (55%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 Y L A S+ +P Q Y+L K+GF+ ++ T ++ FS + +F +LRF D+ Sbjct: 160 YGSVLSACSALRAPIFGKQVYSLVTKNGFLSSGYVQTRMVDLFSKNCNFKEALRFFYDAS 219 Query: 101 DPDTVAWNALISGHARCGQSELAFDLFNRL 12 + WNA+IS + G+S +A +LF ++ Sbjct: 220 RDNVACWNAIISVAIKSGESWVALNLFRQM 249 >ref|XP_002317690.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550328506|gb|EEE98302.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 757 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/93 (32%), Positives = 51/93 (54%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 +P +K + + L + L+ GF LD F+A++LI ++++G + RF Sbjct: 64 FPPVIKCCTGLNNVRLGKVIQDMILEMGFDLDMFVASSLIKLYADNGCIEDARRFFDKMI 123 Query: 101 DPDTVAWNALISGHARCGQSELAFDLFNRLRSS 3 D D V WN +I+G+ +CG+S+ A LF + SS Sbjct: 124 DKDCVLWNVMINGYVQCGESDSAIKLFKDMMSS 156 >ref|XP_002310070.2| hypothetical protein POPTR_0007s07610g [Populus trichocarpa] gi|550334350|gb|EEE90520.2| hypothetical protein POPTR_0007s07610g [Populus trichocarpa] Length = 494 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/88 (32%), Positives = 49/88 (55%) Frame = -2 Query: 281 YPEALKASSSSFSPHLTDQTYALFLKSGFILDTFLATTLIHRFSNSGDFSRSLRFLLDSH 102 YP KA+S L + +KSGF +D F+A +LIH + + GD + + + Sbjct: 69 YPFLAKATSRLLRKELGVSIHGHVIKSGFEIDRFVANSLIHMYGSCGDIVYARKVFDGTP 128 Query: 101 DPDTVAWNALISGHARCGQSELAFDLFN 18 + V+WN+++ G+A+CG +LA LF+ Sbjct: 129 VKNLVSWNSMVDGYAKCGYLDLARGLFD 156