BLASTX nr result
ID: Paeonia24_contig00042117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00042117 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007018466.1| Endoplasmic reticulum-type calcium-transport... 74 2e-11 ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transport... 74 2e-11 ref|XP_006347866.1| PREDICTED: calcium-transporting ATPase 3, en... 72 1e-10 ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, en... 72 1e-10 ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, en... 72 1e-10 ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [A... 71 2e-10 ref|XP_007227661.1| hypothetical protein PRUPE_ppa000801mg [Prun... 71 2e-10 ref|XP_002285405.1| PREDICTED: calcium-transporting ATPase 3, en... 70 3e-10 emb|CBI19381.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, en... 68 2e-09 ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, en... 68 2e-09 ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citr... 68 2e-09 ref|XP_006433651.1| hypothetical protein CICLE_v10000142mg [Citr... 68 2e-09 gb|EPS69623.1| hypothetical protein M569_05142, partial [Genlise... 67 2e-09 gb|AAD29961.1|AF117296_1 putative endoplasmic reticulum-type cal... 67 3e-09 ref|NP_563860.1| calcium-transporting ATPase 3, ER-type [Arabido... 67 3e-09 gb|AAT68271.1| ECA3 [Arabidopsis thaliana] 67 3e-09 emb|CAA10660.1| Ca2+-ATPase [Arabidopsis thaliana] 67 3e-09 ref|XP_006417494.1| hypothetical protein EUTSA_v10006682mg [Eutr... 67 3e-09 ref|XP_006417493.1| hypothetical protein EUTSA_v10006682mg [Eutr... 67 3e-09 >ref|XP_007018466.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 2 [Theobroma cacao] gi|508723794|gb|EOY15691.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 2 [Theobroma cacao] Length = 734 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVL+FF VDSTKGLTD QV+++ R+YGKNVLPE Sbjct: 1 MEDAYARSVSEVLDFFEVDSTKGLTDTQVSQHARLYGKNVLPE 43 >ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] gi|508723793|gb|EOY15690.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] Length = 1001 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVL+FF VDSTKGLTD QV+++ R+YGKNVLPE Sbjct: 1 MEDAYARSVSEVLDFFEVDSTKGLTDTQVSQHARLYGKNVLPE 43 >ref|XP_006347866.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X2 [Solanum tuberosum] Length = 920 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVLEFF VD TKGLTDLQVT++ YGKNVLP+ Sbjct: 1 MEDAYARSVSEVLEFFAVDPTKGLTDLQVTQHAHSYGKNVLPQ 43 >ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Solanum tuberosum] Length = 1000 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVLEFF VD TKGLTDLQVT++ YGKNVLP+ Sbjct: 1 MEDAYARSVSEVLEFFAVDPTKGLTDLQVTQHAHSYGKNVLPQ 43 >ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Solanum lycopersicum] Length = 1000 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVLEFF VD TKGLTDLQVT++ YGKNVLP+ Sbjct: 1 MEDAYARSVSEVLEFFAVDPTKGLTDLQVTQHAHSYGKNVLPQ 43 >ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] gi|548861203|gb|ERN18587.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] Length = 1001 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARS++EVLE FRVD TKGL DLQV EN R YG+NVLP+ Sbjct: 1 MEDAYARSISEVLEAFRVDPTKGLADLQVAENARTYGRNVLPQ 43 >ref|XP_007227661.1| hypothetical protein PRUPE_ppa000801mg [Prunus persica] gi|462424597|gb|EMJ28860.1| hypothetical protein PRUPE_ppa000801mg [Prunus persica] Length = 999 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSVTEVL+FF VD +GLTD QVT++ R+YGKNVLPE Sbjct: 1 MEDAYARSVTEVLDFFGVDPKRGLTDAQVTQHARLYGKNVLPE 43 >ref|XP_002285405.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Vitis vinifera] Length = 999 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV EVLEFF VD TKGLTD Q+++ RIYG+NVLPE Sbjct: 1 MEDAYARSVAEVLEFFEVDPTKGLTDSQISKYARIYGRNVLPE 43 >emb|CBI19381.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV EVLEFF VD TKGLTD Q+++ RIYG+NVLPE Sbjct: 1 MEDAYARSVAEVLEFFEVDPTKGLTDSQISKYARIYGRNVLPE 43 >ref|XP_006472319.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X2 [Citrus sinensis] Length = 992 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV EVL+FF VD TKGLTD QV + RIYGKNVLP+ Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYGKNVLPQ 43 >ref|XP_006472318.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Citrus sinensis] Length = 1001 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV EVL+FF VD TKGLTD QV + RIYGKNVLP+ Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYGKNVLPQ 43 >ref|XP_006433652.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] gi|557535774|gb|ESR46892.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] Length = 1001 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV EVL+FF VD TKGLTD QV + RIYGKNVLP+ Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYGKNVLPQ 43 >ref|XP_006433651.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] gi|557535773|gb|ESR46891.1| hypothetical protein CICLE_v10000142mg [Citrus clementina] Length = 787 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV EVL+FF VD TKGLTD QV + RIYGKNVLP+ Sbjct: 1 MEDAYARSVVEVLDFFGVDPTKGLTDSQVARHVRIYGKNVLPQ 43 >gb|EPS69623.1| hypothetical protein M569_05142, partial [Genlisea aurea] Length = 861 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDA+ARSV EVLEFF VD +GL D QV E GR+YGKNVLP+ Sbjct: 1 MEDAFARSVNEVLEFFNVDPARGLADFQVAEYGRLYGKNVLPQ 43 >gb|AAD29961.1|AF117296_1 putative endoplasmic reticulum-type calcium-transporting ATPase 3 [Arabidopsis thaliana] Length = 998 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG+NVLPE Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYGRNVLPE 43 >ref|NP_563860.1| calcium-transporting ATPase 3, ER-type [Arabidopsis thaliana] gi|19865112|sp|Q9SY55.3|ECA3_ARATH RecName: Full=Calcium-transporting ATPase 3, endoplasmic reticulum-type; Short=AtECA3 gi|13162529|gb|AAC34328.2| calcium-transporting ATPase, ECA3 [Arabidopsis thaliana] gi|110738280|dbj|BAF01069.1| putative calcium ATPase [Arabidopsis thaliana] gi|156145808|gb|ABU53680.1| endomembrane calcium ATPase 3 [Arabidopsis thaliana] gi|332190424|gb|AEE28545.1| calcium-transporting ATPase 3 [Arabidopsis thaliana] Length = 998 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG+NVLPE Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYGRNVLPE 43 >gb|AAT68271.1| ECA3 [Arabidopsis thaliana] Length = 997 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG+NVLPE Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYGRNVLPE 43 >emb|CAA10660.1| Ca2+-ATPase [Arabidopsis thaliana] Length = 998 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSV+EVL+FF VD TKGL+D QV + R+YG+NVLPE Sbjct: 1 MEDAYARSVSEVLDFFGVDPTKGLSDSQVVHHSRLYGRNVLPE 43 >ref|XP_006417494.1| hypothetical protein EUTSA_v10006682mg [Eutrema salsugineum] gi|557095265|gb|ESQ35847.1| hypothetical protein EUTSA_v10006682mg [Eutrema salsugineum] Length = 722 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSVTEVL+FF VD TKGL+D QV + R++G+NVLPE Sbjct: 1 MEDAYARSVTEVLDFFGVDPTKGLSDSQVDHHSRLFGRNVLPE 43 >ref|XP_006417493.1| hypothetical protein EUTSA_v10006682mg [Eutrema salsugineum] gi|557095264|gb|ESQ35846.1| hypothetical protein EUTSA_v10006682mg [Eutrema salsugineum] Length = 998 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -1 Query: 130 MEDAYARSVTEVLEFFRVDSTKGLTDLQVTENGRIYGKNVLPE 2 MEDAYARSVTEVL+FF VD TKGL+D QV + R++G+NVLPE Sbjct: 1 MEDAYARSVTEVLDFFGVDPTKGLSDSQVDHHSRLFGRNVLPE 43