BLASTX nr result
ID: Paeonia24_contig00042079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia24_contig00042079 (371 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis] 53 6e-06 >gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis] Length = 558 Score = 53.1 bits (126), Expect(2) = 6e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 236 TIVEVDVTYVKPFEIGTIVIALGQSLNALITAD 334 T+VEVD TYVKPF I TIVIA GQ+ NALITAD Sbjct: 242 TVVEVDATYVKPFSIDTIVIAPGQTTNALITAD 274 Score = 22.3 bits (46), Expect(2) = 6e-06 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 Query: 204 EELLFKIDGHK 236 EEL FKI GHK Sbjct: 230 EELFFKIAGHK 240